Identified secondary metabolite clusters

Cluster Type From To Size (kb) Core domains Most similar known cluster MIBiG BGC-ID
The following clusters are from record chr1_PeraB:
Cluster 1Putative551095714714163.62Aminotran_1_2, UbiA--
Cluster 2Terpene2067625021005445329.19Epimerase, Terpene_synth, Terpene_synth_C--
Cluster 3Terpene2101505921236929221.87Terpene_synth, Terpene_synth_C--
Cluster 4Terpene2673121626841772110.56Prenyltrans, SE, SQHop_cyclase_C, SQHop_cyclase_N, Transferase--
Cluster 5Cf_putative2837976828579333199.56--
The following clusters are from record chr1_PeraA:
Cluster 6Cf_putative3112266318613473.87--
Cluster 7Cf_putative4108397417299064.59--
Cluster 8Putative48557105020685164.97Aminotran_1_2, UbiA--
Cluster 9Terpene2043716720957598520.43Epimerase, Methyltransf_11, Terpene_synth, Terpene_synth_C--
Cluster 10Terpene2097083021250938280.11Terpene_synth, Terpene_synth_C--
Cluster 11Terpene2670989526819369109.47SE, SQHop_cyclase_C, SQHop_cyclase_N, Transferase--
Cluster 12Cf_putative2828744528497969210.52--
Cluster 13Putative2869804928853403155.35Cellulose_synt, Peptidase_S10, Transferase--
The following clusters are from record chr2_PeraB:
Cluster 14Lignan604894769445164.55Dirigent, Methyltransf_2, p450--
Cluster 15Terpene14472371707266260.03AMP-binding, Lipoxygenase, Terpene_synth--
Cluster 16Putative36884744027994339.52Transferase, p450--
Cluster 17Saccharide1155804411712305154.26Aminotran_1_2, UDPGT_2--
Cluster 18Terpene1759230417776940184.64Methyltransf_11, Prenyltrans, Terpene_synth, Terpene_synth_C--
Cluster 19Terpene288148632887824663.38Epimerase, Terpene_synth, Terpene_synth_C--
Cluster 20Cf_putative314020843147652474.44--
The following clusters are from record chr2_PeraA:
Cluster 21Lignan23013802403610102.23Dirigent, Methyltransf_2, p450--
Cluster 22Lignan2419860246440044.54Dirigent, Methyltransf_2, p450--
Cluster 23Terpene31565133390984234.47AMP-binding, Lipoxygenase, Terpene_synth--
Cluster 24Terpene195321591963003697.88Prenyltrans, Terpene_synth, Terpene_synth_C--
Cluster 25Terpene306544103071367659.27Epimerase, Terpene_synth, Terpene_synth_C--
Cluster 26Cf_putative332309263330094370.02--
The following clusters are from record chr3_PeraB:
Cluster 27Cyclopeptide29089043154325245.42BURP--
Cluster 28Terpene3738088381455676.47Terpene_synth, Terpene_synth_C, p450--
Cluster 29Alkaloid6223019626798244.96Cu_amine_oxid, Epimerase, p450--
Cluster 30Cf_putative67590916879466120.38--
Cluster 31Cf_putative70839007218809134.91--
Cluster 32Putative1327340913707798434.392OG-FeII_Oxy, DIOX_N, Epimerase, p450, polyprenyl_synt--
Cluster 33Putative386267423870566778.92Methyltransf_2, p450--
Cluster 34Putative3950541139716864211.45AMP-binding, Cellulose_synt, Methyltransf_2, p450--
The following clusters are from record chr3_PeraA:
Cluster 35Cyclopeptide28586913145117286.43BURP--
Cluster 36Terpene3707038379155884.52Terpene_synth, Terpene_synth_C, p450--
Cluster 37Alkaloid6162991621993456.94Cu_amine_oxid, Epimerase, p450--
Cluster 38Cf_putative67134076830492117.08--
Cluster 39Putative3912932639370215240.89AMP-binding, Cellulose_synt, Methyltransf_2, p450--
The following clusters are from record chr4_PeraB:
Cluster 40Cf_putative23496382572991223.35--
Cluster 41Cf_putative1919375919342383148.62--
Cluster 42Cf_putative2215379822324153170.35--
Cluster 43Putative2452545324709933184.48COesterase, Transferase, p450--
Cluster 44Cyclopeptide2541633325681871265.54BURP--
Cluster 45Cf_putative277388422779280753.97--
The following clusters are from record chr4_PeraA:
Cluster 46Cf_putative24162852658126241.84--
Cluster 47Putative183743581847141497.06Amino_oxidase, p450--
Cluster 48Cf_putative198236471991233688.69--
Cluster 49Cf_putative2316617823334296168.12--
Cluster 50Putative2570179725893525191.73COesterase, Transferase, p450--
Cluster 51Cyclopeptide2664600726937246291.24BURP--
Cluster 52Cf_putative290323102910027067.96--
The following clusters are from record chr5_PeraB:
Cluster 53Cf_putative6451112191151154.60--
Cluster 54Cf_putative50524535259194206.74--
Cluster 55Terpene-Polyketide90294689358801329.33Chal_sti_synt_C, Terpene_synth, Terpene_synth_C--
Cluster 56Saccharide1905232519833014780.69Epimerase, UDPGT_2, p450--
Cluster 57Cf_putative2630166026737448435.79--
Cluster 58Saccharide289865452905330266.76Aminotran_1_2, Glycos_transf_2, SE--
Cluster 59Polyketide313538373139463240.80Aminotran_1_2, Chal_sti_synt_C, Chal_sti_synt_N--
Cluster 60Polyketide323661423242851062.37Chal_sti_synt_N, Epimerase, Methyltransf_2--
Cluster 61Terpene329610553303343072.38Cellulose_synt, Terpene_synth, Terpene_synth_C, p450--
Cluster 62Cf_putative366559153671900863.09--
The following clusters are from record chr5_PeraA:
Cluster 63Cf_putative102302862732760.43--
Cluster 64Cf_putative47007894994818294.03--
Cluster 65Polyketide91767459664355487.61Chal_sti_synt_C, Methyltransf_2--
Cluster 66Cyclopeptide1683382317715498881.67BURP--
Cluster 67Saccharide1973524019880717145.48Epimerase, UDPGT_2, p450--
Cluster 68Cf_putative2064600821228334582.33--
Cluster 69Cf_putative26987674288185911830.92--
Cluster 70Saccharide307767923083956762.77Aminotran_1_2, Glycos_transf_2, SE--
Cluster 71Saccharide322063063226227855.97UDPGT_2, p450--
Cluster 72Polyketide331191483316564246.49Aminotran_1_2, Chal_sti_synt_C, Chal_sti_synt_N--
Cluster 73Polyketide3384977233969720119.95AMP-binding, Chal_sti_synt_N, DIOX_N--
Cluster 74Terpene347391023479924960.15Cellulose_synt, Terpene_synth, Terpene_synth_C, p450--
Cluster 75Cf_putative384491963851165962.46--
The following clusters are from record chr6_PeraB:
Cluster 76Cf_putative32032324117649914.42--
Cluster 77Cf_putative1253693213070273533.34--
Cluster 78Saccharide1801606618162092146.03AMP-binding, Epimerase, UDPGT_2--
The following clusters are from record chr6_PeraA:
Cluster 79Saccharide186416221872333081.71Epimerase, UDPGT_2--
Cluster 80Saccharide1875174718877576125.83Aminotran_3, UDPGT_2, p450--
Cluster 81Saccharide2170546121805585100.12ERG4_ERG24, Glycos_transf_2, p450--
Cluster 82Cf_putative246308842471222581.34--
The following clusters are from record chr7_PeraA:
Cluster 83Cf_putative21666432285058118.42--
Cluster 84Putative1034152610509233167.71Aminotran_1_2, DIOX_N--
Cluster 85Putative1620282216390150187.33UbiA, p450--
Cluster 86Cf_putative254929192556558772.67--
Cluster 87Polyketide2682963027003398173.77Chal_sti_synt_N, Methyltransf_2, p450--
The following clusters are from record chr7_PeraB:
Cluster 88Cf_putative22430932357344114.25--
Cluster 89Saccharide5860499595311792.62Aminotran_1_2, COesterase, UDPGT_2--
Cluster 90Putative1060617210785674179.50Aminotran_1_2, DIOX_N--
Cluster 91Putative1757042117821015250.59Methyltransf_2, UbiA, p450--
Cluster 92Putative2640706026588510181.45Methyltransf_2, Transferase--
Cluster 93Cf_putative277283752781426085.89--
Cluster 94Putative2839521528839914444.70Transferase, p450--
The following clusters are from record chr8_PeraA:
Cluster 95Putative6019606608700067.39COesterase, Peptidase_S10--
Cluster 96Cyclopeptide68777297686393808.66BURP--
Cluster 97Cyclopeptide69483897366048417.66BURP--
Cluster 98Cf_putative78308268009890179.06--
Cluster 99Lignan1076753510977918210.38Dirigent, p450--
Cluster 100Polyketide1258220513320493738.29Chal_sti_synt_N, Epimerase, p450--
Cluster 101Saccharide1595214316381240429.10Transferase, UDPGT_2, UbiA--
Cluster 102Saccharide-Terpene2814071128422273281.56Glycos_transf_2, Terpene_synth, Terpene_synth_C--
Cluster 103Cf_putative312567703133302576.25--
The following clusters are from record chr8_PeraB:
Cluster 104Cf_putative1418931150718988.26--
Cluster 105Cyclopeptide45114895331173819.68BURP--
Cluster 106Cyclopeptide45258614885598359.74BURP--
Cluster 107Cf_putative54682325681720213.49--
Cluster 108Lignan84711959002165530.97Dirigent, p450--
Cluster 109Polyketide1121698711631572414.58Chal_sti_synt_N, Epimerase, p450--
Cluster 110Saccharide1412558614542263416.68DIOX_N, Transferase, UDPGT_2, UbiA--
The following clusters are from record chr9_PeraA:
Cluster 111Alkaloid1461966155449792.53Bet_v_1, HMGL-like--
Cluster 112Cf_putative1731274180653875.26--
Cluster 113Cf_putative3369906343140561.50--
Cluster 114Alkaloid36538983807369153.47Cu_amine_oxid, Lipoxygenase--
Cluster 115Cf_putative45452864766239220.95--
Cluster 116Putative55861615720139133.982OG-FeII_Oxy, DIOX_N, Transferase--
Cluster 117Cf_putative6906123700608599.96--
Cluster 118Cf_putative1392248714417817495.33--
Cluster 119Cf_putative2098743621141988154.55--
Cluster 120Cf_putative267779382687269794.76--
The following clusters are from record chr9_PeraB:
Cluster 121Alkaloid11764991289756113.26Bet_v_1, HMGL-like--
Cluster 122Cf_putative1456674153424277.57--
Cluster 123Cf_putative3043264310071057.45--
Cluster 124Cf_putative41490204366112217.09--
Cluster 125Putative53124845418537106.052OG-FeII_Oxy, DIOX_N, Transferase--
Cluster 126Cf_putative65340466743785209.74--
Cluster 127Cf_putative1550614015756620250.48--
Cluster 128Saccharide2010029020427548327.26Methyltransf_11, UDPGT_2--
Cluster 129Cf_putative2293966123135682196.02--
Cluster 130Cf_putative286774332876662589.19--

chr1_PeraB - Cluster 1 - Putative

Gene cluster description

Download cluster GenBank file
chr1_PeraB - Gene Cluster 1. Type = putative. Location: 551095 - 714714 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1_PeraB - Cluster 2 - Terpene

Gene cluster description

Download cluster GenBank file
chr1_PeraB - Gene Cluster 2. Type = terpene. Location: 20676250 - 21005445 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1_PeraB - Cluster 3 - Terpene

Gene cluster description

Download cluster GenBank file
chr1_PeraB - Gene Cluster 3. Type = terpene. Location: 21015059 - 21236929 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1_PeraB - Cluster 4 - Terpene

Gene cluster description

Download cluster GenBank file
chr1_PeraB - Gene Cluster 4. Type = terpene. Location: 26731216 - 26841772 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1_PeraB - Cluster 5 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr1_PeraB - Gene Cluster 5. Type = cf_putative. Location: 28379768 - 28579333 nt. ClusterFinder probability: 0.9541. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1_PeraA - Cluster 6 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr1_PeraA - Gene Cluster 6. Type = cf_putative. Location: 3112266 - 3186134 nt. ClusterFinder probability: 0.9389. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1_PeraA - Cluster 7 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr1_PeraA - Gene Cluster 7. Type = cf_putative. Location: 4108397 - 4172990 nt. ClusterFinder probability: 0.9389. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1_PeraA - Cluster 8 - Putative

Gene cluster description

Download cluster GenBank file
chr1_PeraA - Gene Cluster 8. Type = putative. Location: 4855710 - 5020685 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1_PeraA - Cluster 9 - Terpene

Gene cluster description

Download cluster GenBank file
chr1_PeraA - Gene Cluster 9. Type = terpene. Location: 20437167 - 20957598 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1_PeraA - Cluster 10 - Terpene

Gene cluster description

Download cluster GenBank file
chr1_PeraA - Gene Cluster 10. Type = terpene. Location: 20970830 - 21250938 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1_PeraA - Cluster 11 - Terpene

Gene cluster description

Download cluster GenBank file
chr1_PeraA - Gene Cluster 11. Type = terpene. Location: 26709895 - 26819369 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1_PeraA - Cluster 12 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr1_PeraA - Gene Cluster 12. Type = cf_putative. Location: 28287445 - 28497969 nt. ClusterFinder probability: 0.9531. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1_PeraA - Cluster 13 - Putative

Gene cluster description

Download cluster GenBank file
chr1_PeraA - Gene Cluster 13. Type = putative. Location: 28698049 - 28853403 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2_PeraB - Cluster 14 - Lignan

Gene cluster description

Download cluster GenBank file
chr2_PeraB - Gene Cluster 14. Type = lignan. Location: 604894 - 769445 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2_PeraB - Cluster 15 - Terpene

Gene cluster description

Download cluster GenBank file
chr2_PeraB - Gene Cluster 15. Type = terpene. Location: 1447237 - 1707266 nt. ClusterFinder probability: 0.8175. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2_PeraB - Cluster 16 - Putative

Gene cluster description

Download cluster GenBank file
chr2_PeraB - Gene Cluster 16. Type = putative. Location: 3688474 - 4027994 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2_PeraB - Cluster 17 - Saccharide

Gene cluster description

Download cluster GenBank file
chr2_PeraB - Gene Cluster 17. Type = saccharide. Location: 11558044 - 11712305 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2_PeraB - Cluster 18 - Terpene

Gene cluster description

Download cluster GenBank file
chr2_PeraB - Gene Cluster 18. Type = terpene. Location: 17592304 - 17776940 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2_PeraB - Cluster 19 - Terpene

Gene cluster description

Download cluster GenBank file
chr2_PeraB - Gene Cluster 19. Type = terpene. Location: 28814863 - 28878246 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2_PeraB - Cluster 20 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr2_PeraB - Gene Cluster 20. Type = cf_putative. Location: 31402084 - 31476524 nt. ClusterFinder probability: 0.9653. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2_PeraA - Cluster 21 - Lignan

Gene cluster description

Download cluster GenBank file
chr2_PeraA - Gene Cluster 21. Type = lignan. Location: 2301380 - 2403610 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2_PeraA - Cluster 22 - Lignan

Gene cluster description

Download cluster GenBank file
chr2_PeraA - Gene Cluster 22. Type = lignan. Location: 2419860 - 2464400 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2_PeraA - Cluster 23 - Terpene

Gene cluster description

Download cluster GenBank file
chr2_PeraA - Gene Cluster 23. Type = terpene. Location: 3156513 - 3390984 nt. ClusterFinder probability: 0.8175. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2_PeraA - Cluster 24 - Terpene

Gene cluster description

Download cluster GenBank file
chr2_PeraA - Gene Cluster 24. Type = terpene. Location: 19532159 - 19630036 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2_PeraA - Cluster 25 - Terpene

Gene cluster description

Download cluster GenBank file
chr2_PeraA - Gene Cluster 25. Type = terpene. Location: 30654410 - 30713676 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2_PeraA - Cluster 26 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr2_PeraA - Gene Cluster 26. Type = cf_putative. Location: 33230926 - 33300943 nt. ClusterFinder probability: 0.9659. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3_PeraB - Cluster 27 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr3_PeraB - Gene Cluster 27. Type = cyclopeptide. Location: 2908904 - 3154325 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3_PeraB - Cluster 28 - Terpene

Gene cluster description

Download cluster GenBank file
chr3_PeraB - Gene Cluster 28. Type = terpene. Location: 3738088 - 3814556 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3_PeraB - Cluster 29 - Alkaloid

Gene cluster description

Download cluster GenBank file
chr3_PeraB - Gene Cluster 29. Type = alkaloid. Location: 6223019 - 6267982 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3_PeraB - Cluster 30 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr3_PeraB - Gene Cluster 30. Type = cf_putative. Location: 6759091 - 6879466 nt. ClusterFinder probability: 0.9934. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3_PeraB - Cluster 31 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr3_PeraB - Gene Cluster 31. Type = cf_putative. Location: 7083900 - 7218809 nt. ClusterFinder probability: 0.8294. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3_PeraB - Cluster 32 - Putative

Gene cluster description

Download cluster GenBank file
chr3_PeraB - Gene Cluster 32. Type = putative. Location: 13273409 - 13707798 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3_PeraB - Cluster 33 - Putative

Gene cluster description

Download cluster GenBank file
chr3_PeraB - Gene Cluster 33. Type = putative. Location: 38626742 - 38705667 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3_PeraB - Cluster 34 - Putative

Gene cluster description

Download cluster GenBank file
chr3_PeraB - Gene Cluster 34. Type = putative. Location: 39505411 - 39716864 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3_PeraA - Cluster 35 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr3_PeraA - Gene Cluster 35. Type = cyclopeptide. Location: 2858691 - 3145117 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3_PeraA - Cluster 36 - Terpene

Gene cluster description

Download cluster GenBank file
chr3_PeraA - Gene Cluster 36. Type = terpene. Location: 3707038 - 3791558 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3_PeraA - Cluster 37 - Alkaloid

Gene cluster description

Download cluster GenBank file
chr3_PeraA - Gene Cluster 37. Type = alkaloid. Location: 6162991 - 6219934 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3_PeraA - Cluster 38 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr3_PeraA - Gene Cluster 38. Type = cf_putative. Location: 6713407 - 6830492 nt. ClusterFinder probability: 0.9933. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3_PeraA - Cluster 39 - Putative

Gene cluster description

Download cluster GenBank file
chr3_PeraA - Gene Cluster 39. Type = putative. Location: 39129326 - 39370215 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4_PeraB - Cluster 40 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4_PeraB - Gene Cluster 40. Type = cf_putative. Location: 2349638 - 2572991 nt. ClusterFinder probability: 0.9908. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4_PeraB - Cluster 41 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4_PeraB - Gene Cluster 41. Type = cf_putative. Location: 19193759 - 19342383 nt. ClusterFinder probability: 0.9245. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4_PeraB - Cluster 42 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4_PeraB - Gene Cluster 42. Type = cf_putative. Location: 22153798 - 22324153 nt. ClusterFinder probability: 0.9710. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4_PeraB - Cluster 43 - Putative

Gene cluster description

Download cluster GenBank file
chr4_PeraB - Gene Cluster 43. Type = putative. Location: 24525453 - 24709933 nt. ClusterFinder probability: 0.9560. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4_PeraB - Cluster 44 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr4_PeraB - Gene Cluster 44. Type = cyclopeptide. Location: 25416333 - 25681871 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4_PeraB - Cluster 45 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4_PeraB - Gene Cluster 45. Type = cf_putative. Location: 27738842 - 27792807 nt. ClusterFinder probability: 0.9962. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4_PeraA - Cluster 46 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4_PeraA - Gene Cluster 46. Type = cf_putative. Location: 2416285 - 2658126 nt. ClusterFinder probability: 0.8851. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4_PeraA - Cluster 47 - Putative

Gene cluster description

Download cluster GenBank file
chr4_PeraA - Gene Cluster 47. Type = putative. Location: 18374358 - 18471414 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4_PeraA - Cluster 48 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4_PeraA - Gene Cluster 48. Type = cf_putative. Location: 19823647 - 19912336 nt. ClusterFinder probability: 0.9231. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4_PeraA - Cluster 49 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4_PeraA - Gene Cluster 49. Type = cf_putative. Location: 23166178 - 23334296 nt. ClusterFinder probability: 0.9726. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4_PeraA - Cluster 50 - Putative

Gene cluster description

Download cluster GenBank file
chr4_PeraA - Gene Cluster 50. Type = putative. Location: 25701797 - 25893525 nt. ClusterFinder probability: 0.9559. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4_PeraA - Cluster 51 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr4_PeraA - Gene Cluster 51. Type = cyclopeptide. Location: 26646007 - 26937246 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4_PeraA - Cluster 52 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4_PeraA - Gene Cluster 52. Type = cf_putative. Location: 29032310 - 29100270 nt. ClusterFinder probability: 0.9601. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraB - Cluster 53 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr5_PeraB - Gene Cluster 53. Type = cf_putative. Location: 64511 - 1219115 nt. ClusterFinder probability: 0.9699. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraB - Cluster 54 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr5_PeraB - Gene Cluster 54. Type = cf_putative. Location: 5052453 - 5259194 nt. ClusterFinder probability: 0.8898. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraB - Cluster 55 - Terpene-polyketide

Gene cluster description

Download cluster GenBank file
chr5_PeraB - Gene Cluster 55. Type = terpene-polyketide. Location: 9029468 - 9358801 nt. ClusterFinder probability: 0.9657. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraB - Cluster 56 - Saccharide

Gene cluster description

Download cluster GenBank file
chr5_PeraB - Gene Cluster 56. Type = saccharide. Location: 19052325 - 19833014 nt. ClusterFinder probability: 0.9192. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraB - Cluster 57 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr5_PeraB - Gene Cluster 57. Type = cf_putative. Location: 26301660 - 26737448 nt. ClusterFinder probability: 0.9677. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraB - Cluster 58 - Saccharide

Gene cluster description

Download cluster GenBank file
chr5_PeraB - Gene Cluster 58. Type = saccharide. Location: 28986545 - 29053302 nt. ClusterFinder probability: 0.9652. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraB - Cluster 59 - Polyketide

Gene cluster description

Download cluster GenBank file
chr5_PeraB - Gene Cluster 59. Type = polyketide. Location: 31353837 - 31394632 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraB - Cluster 60 - Polyketide

Gene cluster description

Download cluster GenBank file
chr5_PeraB - Gene Cluster 60. Type = polyketide. Location: 32366142 - 32428510 nt. ClusterFinder probability: 0.9525. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraB - Cluster 61 - Terpene

Gene cluster description

Download cluster GenBank file
chr5_PeraB - Gene Cluster 61. Type = terpene. Location: 32961055 - 33033430 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraB - Cluster 62 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr5_PeraB - Gene Cluster 62. Type = cf_putative. Location: 36655915 - 36719008 nt. ClusterFinder probability: 0.9314. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraA - Cluster 63 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr5_PeraA - Gene Cluster 63. Type = cf_putative. Location: 102302 - 862732 nt. ClusterFinder probability: 0.8981. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraA - Cluster 64 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr5_PeraA - Gene Cluster 64. Type = cf_putative. Location: 4700789 - 4994818 nt. ClusterFinder probability: 0.9086. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraA - Cluster 65 - Polyketide

Gene cluster description

Download cluster GenBank file
chr5_PeraA - Gene Cluster 65. Type = polyketide. Location: 9176745 - 9664355 nt. ClusterFinder probability: 0.9716. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraA - Cluster 66 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr5_PeraA - Gene Cluster 66. Type = cyclopeptide. Location: 16833823 - 17715498 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraA - Cluster 67 - Saccharide

Gene cluster description

Download cluster GenBank file
chr5_PeraA - Gene Cluster 67. Type = saccharide. Location: 19735240 - 19880717 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraA - Cluster 68 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr5_PeraA - Gene Cluster 68. Type = cf_putative. Location: 20646008 - 21228334 nt. ClusterFinder probability: 0.9329. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraA - Cluster 69 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr5_PeraA - Gene Cluster 69. Type = cf_putative. Location: 26987674 - 28818591 nt. ClusterFinder probability: 0.9421. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraA - Cluster 70 - Saccharide

Gene cluster description

Download cluster GenBank file
chr5_PeraA - Gene Cluster 70. Type = saccharide. Location: 30776792 - 30839567 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraA - Cluster 71 - Saccharide

Gene cluster description

Download cluster GenBank file
chr5_PeraA - Gene Cluster 71. Type = saccharide. Location: 32206306 - 32262278 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraA - Cluster 72 - Polyketide

Gene cluster description

Download cluster GenBank file
chr5_PeraA - Gene Cluster 72. Type = polyketide. Location: 33119148 - 33165642 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraA - Cluster 73 - Polyketide

Gene cluster description

Download cluster GenBank file
chr5_PeraA - Gene Cluster 73. Type = polyketide. Location: 33849772 - 33969720 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraA - Cluster 74 - Terpene

Gene cluster description

Download cluster GenBank file
chr5_PeraA - Gene Cluster 74. Type = terpene. Location: 34739102 - 34799249 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5_PeraA - Cluster 75 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr5_PeraA - Gene Cluster 75. Type = cf_putative. Location: 38449196 - 38511659 nt. ClusterFinder probability: 0.9329. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6_PeraB - Cluster 76 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr6_PeraB - Gene Cluster 76. Type = cf_putative. Location: 3203232 - 4117649 nt. ClusterFinder probability: 0.8513. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6_PeraB - Cluster 77 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr6_PeraB - Gene Cluster 77. Type = cf_putative. Location: 12536932 - 13070273 nt. ClusterFinder probability: 0.8373. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6_PeraB - Cluster 78 - Saccharide

Gene cluster description

Download cluster GenBank file
chr6_PeraB - Gene Cluster 78. Type = saccharide. Location: 18016066 - 18162092 nt. ClusterFinder probability: 0.9962. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6_PeraA - Cluster 79 - Saccharide

Gene cluster description

Download cluster GenBank file
chr6_PeraA - Gene Cluster 79. Type = saccharide. Location: 18641622 - 18723330 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6_PeraA - Cluster 80 - Saccharide

Gene cluster description

Download cluster GenBank file
chr6_PeraA - Gene Cluster 80. Type = saccharide. Location: 18751747 - 18877576 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6_PeraA - Cluster 81 - Saccharide

Gene cluster description

Download cluster GenBank file
chr6_PeraA - Gene Cluster 81. Type = saccharide. Location: 21705461 - 21805585 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6_PeraA - Cluster 82 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr6_PeraA - Gene Cluster 82. Type = cf_putative. Location: 24630884 - 24712225 nt. ClusterFinder probability: 0.8879. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7_PeraA - Cluster 83 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr7_PeraA - Gene Cluster 83. Type = cf_putative. Location: 2166643 - 2285058 nt. ClusterFinder probability: 0.9809. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7_PeraA - Cluster 84 - Putative

Gene cluster description

Download cluster GenBank file
chr7_PeraA - Gene Cluster 84. Type = putative. Location: 10341526 - 10509233 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7_PeraA - Cluster 85 - Putative

Gene cluster description

Download cluster GenBank file
chr7_PeraA - Gene Cluster 85. Type = putative. Location: 16202822 - 16390150 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7_PeraA - Cluster 86 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr7_PeraA - Gene Cluster 86. Type = cf_putative. Location: 25492919 - 25565587 nt. ClusterFinder probability: 0.9462. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7_PeraA - Cluster 87 - Polyketide

Gene cluster description

Download cluster GenBank file
chr7_PeraA - Gene Cluster 87. Type = polyketide. Location: 26829630 - 27003398 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7_PeraB - Cluster 88 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr7_PeraB - Gene Cluster 88. Type = cf_putative. Location: 2243093 - 2357344 nt. ClusterFinder probability: 0.9833. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7_PeraB - Cluster 89 - Saccharide

Gene cluster description

Download cluster GenBank file
chr7_PeraB - Gene Cluster 89. Type = saccharide. Location: 5860499 - 5953117 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7_PeraB - Cluster 90 - Putative

Gene cluster description

Download cluster GenBank file
chr7_PeraB - Gene Cluster 90. Type = putative. Location: 10606172 - 10785674 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7_PeraB - Cluster 91 - Putative

Gene cluster description

Download cluster GenBank file
chr7_PeraB - Gene Cluster 91. Type = putative. Location: 17570421 - 17821015 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7_PeraB - Cluster 92 - Putative

Gene cluster description

Download cluster GenBank file
chr7_PeraB - Gene Cluster 92. Type = putative. Location: 26407060 - 26588510 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7_PeraB - Cluster 93 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr7_PeraB - Gene Cluster 93. Type = cf_putative. Location: 27728375 - 27814260 nt. ClusterFinder probability: 0.9471. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7_PeraB - Cluster 94 - Putative

Gene cluster description

Download cluster GenBank file
chr7_PeraB - Gene Cluster 94. Type = putative. Location: 28395215 - 28839914 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8_PeraA - Cluster 95 - Putative

Gene cluster description

Download cluster GenBank file
chr8_PeraA - Gene Cluster 95. Type = putative. Location: 6019606 - 6087000 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8_PeraA - Cluster 96 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr8_PeraA - Gene Cluster 96. Type = cyclopeptide. Location: 6877729 - 7686393 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
Repeat found in evm.model.chr8B.1406
Repeat occurs 5 times in a sequence of 237 amino acids
Location between 7287502 and 7288530
Coverage of 18.99 %
Instances:
SIYDNGIKP | SIYDNAIKP | SIYDNGIKP | SIYDNGVKL | SIYNNGVKL

pattern: SIY[DN]N[AG][IV]K[PL]
The following known motifs were found:
VS[AI]Y was found 5 times in this sequence
MNIKAFFVLSTVLSLLLLFANMIDARKDLRDYWRIVVKNQDMPGESTQGLIPEDQASTISKTT
AYCHTHEDSEHAMEKPFVNKNLELMPDVSIYDNGIKPTKQKAFVKDLELMPDVSIYDNAIKPKD
KQRSFAKNFEFMPDVSIYDNGIKPTEQKFFAKDFELMPDVSIYDNGVKLPKQRFSAKDFELMPD
VSIYNNGVKLAKQKAFAKDFELMMMFQFMTMILNQRRRVHMPRTLS
Repeat found in evm.model.chr8B.1399
Repeat occurs 4 times in a sequence of 218 amino acids
Location between 7204900 and 7205874
Coverage of 18.35 %
Instances:
SIYDNGIKPK | SIYDNGIKPT | SIYDNGIKPT | SIYDNDIKPT |
pattern: SIYDN[DG]IKP[KT]
MNIKAFFVLSTVLSLLLLFANMIDARKDLGDDWSIVVKNQDIPGESAQGLIPEDQGSTISKTK
AYCHTHDDPEHTMEKPFVNKKFELMPDVSIYDNGIKPKDQQRSFAKNFELMPDLSIYDNGIKPT
TQKAFAKNFELMPDLSIYDNGIKPTKQKFFAKNFEFMPDISIYDNDIKPTKRSSYAKDFELKAD
ISIHEPTEQKSVVSSTDLQPDDTIYHN
Repeat found in evm.model.chr8B.1419
Repeat occurs 9 times in a sequence of 295 amino acids
Location between 7360388 and 7361398
Coverage of 18.31 %
Instances:
ATIDIL | ATIYHN | ATIYHN | ATIYLN | ATIYHN
ATIYHN | ATIYHN | ATIYHN | ATIYHE |
pattern: ATI[YD][IHL][ELN]
MNLKAFFVLSAVLSLLLLFANRTEARKDQGEYWRGFVKDSDVPESIQIHVRQDPVSTASDAKA
HCKEPEDLEHKREKTYVKDSEATIDILVYTNSIKPTEQKLFGSHFESSPDATIYHNDIKPTEQK
LFGNHFESSPDATIYHNDIKPGEQKLFGNHFESSPDATIYLNAIKPGEQKLFGNHFESSPDATI
YHNDIKPTEQKLFGNHFESSPDATIYHNDIKLTEQKLFGNHFESSPDATIYHNDIKPGEQKLFG
NHFESSPDATIYHNDIKPMEMIKSFVSKFLSNPDATIYHE

Similar gene clusters

No significant ClusterBlast hits found.

chr8_PeraA - Cluster 97 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr8_PeraA - Gene Cluster 97. Type = cyclopeptide. Location: 6948389 - 7366048 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
Repeat found in evm.model.chr8B.1399
Repeat occurs 4 times in a sequence of 218 amino acids
Location between 7204900 and 7205874
Coverage of 18.35 %
Instances:
SIYDNGIKPK | SIYDNGIKPT | SIYDNGIKPT | SIYDNDIKPT |
pattern: SIYDN[DG]IKP[KT]
MNIKAFFVLSTVLSLLLLFANMIDARKDLGDDWSIVVKNQDIPGESAQGLIPEDQGSTISKTK
AYCHTHDDPEHTMEKPFVNKKFELMPDVSIYDNGIKPKDQQRSFAKNFELMPDLSIYDNGIKPT
TQKAFAKNFELMPDLSIYDNGIKPTKQKFFAKNFEFMPDISIYDNDIKPTKRSSYAKDFELKAD
ISIHEPTEQKSVVSSTDLQPDDTIYHN
Repeat found in evm.model.chr8B.1419
Repeat occurs 9 times in a sequence of 295 amino acids
Location between 7360388 and 7361398
Coverage of 18.31 %
Instances:
ATIDIL | ATIYHN | ATIYHN | ATIYLN | ATIYHN
ATIYHN | ATIYHN | ATIYHN | ATIYHE |
pattern: ATI[YD][IHL][ELN]
MNLKAFFVLSAVLSLLLLFANRTEARKDQGEYWRGFVKDSDVPESIQIHVRQDPVSTASDAKA
HCKEPEDLEHKREKTYVKDSEATIDILVYTNSIKPTEQKLFGSHFESSPDATIYHNDIKPTEQK
LFGNHFESSPDATIYHNDIKPGEQKLFGNHFESSPDATIYLNAIKPGEQKLFGNHFESSPDATI
YHNDIKPTEQKLFGNHFESSPDATIYHNDIKLTEQKLFGNHFESSPDATIYHNDIKPGEQKLFG
NHFESSPDATIYHNDIKPMEMIKSFVSKFLSNPDATIYHE
Repeat found in evm.model.chr8B.1406
Repeat occurs 5 times in a sequence of 237 amino acids
Location between 7287502 and 7288530
Coverage of 18.99 %
Instances:
SIYDNGIKP | SIYDNAIKP | SIYDNGIKP | SIYDNGVKL | SIYNNGVKL

pattern: SIY[DN]N[AG][IV]K[PL]
The following known motifs were found:
VS[AI]Y was found 5 times in this sequence
MNIKAFFVLSTVLSLLLLFANMIDARKDLRDYWRIVVKNQDMPGESTQGLIPEDQASTISKTT
AYCHTHEDSEHAMEKPFVNKNLELMPDVSIYDNGIKPTKQKAFVKDLELMPDVSIYDNAIKPKD
KQRSFAKNFEFMPDVSIYDNGIKPTEQKFFAKDFELMPDVSIYDNGVKLPKQRFSAKDFELMPD
VSIYNNGVKLAKQKAFAKDFELMMMFQFMTMILNQRRRVHMPRTLS

Similar gene clusters

No significant ClusterBlast hits found.

chr8_PeraA - Cluster 98 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr8_PeraA - Gene Cluster 98. Type = cf_putative. Location: 7830826 - 8009890 nt. ClusterFinder probability: 0.9608. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8_PeraA - Cluster 99 - Lignan

Gene cluster description

Download cluster GenBank file
chr8_PeraA - Gene Cluster 99. Type = lignan. Location: 10767535 - 10977918 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8_PeraA - Cluster 100 - Polyketide

Gene cluster description

Download cluster GenBank file
chr8_PeraA - Gene Cluster 100. Type = polyketide. Location: 12582205 - 13320493 nt. ClusterFinder probability: 0.9527. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8_PeraA - Cluster 101 - Saccharide

Gene cluster description

Download cluster GenBank file
chr8_PeraA - Gene Cluster 101. Type = saccharide. Location: 15952143 - 16381240 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8_PeraA - Cluster 102 - Saccharide-terpene

Gene cluster description

Download cluster GenBank file
chr8_PeraA - Gene Cluster 102. Type = saccharide-terpene. Location: 28140711 - 28422273 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8_PeraA - Cluster 103 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr8_PeraA - Gene Cluster 103. Type = cf_putative. Location: 31256770 - 31333025 nt. ClusterFinder probability: 0.7392. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8_PeraB - Cluster 104 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr8_PeraB - Gene Cluster 104. Type = cf_putative. Location: 1418931 - 1507189 nt. ClusterFinder probability: 0.8912. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8_PeraB - Cluster 105 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr8_PeraB - Gene Cluster 105. Type = cyclopeptide. Location: 4511489 - 5331173 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
Repeat found in evm.model.chr8A.813
Repeat occurs 6 times in a sequence of 220 amino acids
Location between 4985453 and 4986235
Coverage of 16.36 %
Instances:
ATIDIL | ATIYHN | ATIYHN | ATIYHN | ATIYHN
ATIYHE |
pattern: ATI[YD][IH][ELN]
MNLKAFFVLSAVLSLLLLFANRTEARKDQGEYWRGFVKDSDVPESIQIHVRQDPVSTASDAKA
HCKEPEDLEHKREKTYVKDSDATIDILVYHNSIKPTEQKLFGNHFESSPDATIYHNDIKPTEQK
LFGNHFESSPDATIYHNDIKPTEQKLFTNHFESSPDATIYHNDIKPTVQKLFANHFVSSPDATI
YHNDIKPIEMIKSFVSKFLSNPDATIYHE
Repeat found in evm.model.chr8A.811
Repeat occurs 5 times in a sequence of 237 amino acids
Location between 4959743 and 4960772
Coverage of 16.88 %
Instances:
SIYDNGIK | SIYDNGIK | SIYDNGIK | SIYDNGVK | SIYNNGVK

pattern: SIY[DN]NG[IV]K
The following known motifs were found:
VS[AI]Y was found 5 times in this sequence
MNIKAFFVLSTLLSLLLLFANMIDARKDLRDYWRIVVKNEDMPGESTQGLIPEDQASTISKTT
AYCRTHEDSEHTMEKPFVNKNLELMPDVSIYDNGIKTTKQKAFVKDLELMPDVSIYDNGIKPKD
KQRSFAKNFEFMPDVSIYDNGIKPTEQKFFAKDFELMPDVSIYDNGVKLPKQRFSAKDFELMPD
VSIYNNGVKLAKQRHSPKTSSSCLMFQFMTMILNQRRRVHMPRTLS
Repeat found in evm.model.chr8A.816
Repeat occurs 7 times in a sequence of 267 amino acids
Location between 4996919 and 4998038
Coverage of 20.97 %
Instances:
SIYDNGVK | SIYDNGIK | SIYDNGIK | SIYDNGIK | SIYDNGVK
SIYNNGVE | SIYDNDIK |
pattern: SIY[DN]N[DG][IV][KE]
The following known motifs were found:
VS[AI]Y was found 7 times in this sequence
MNIKALFVLSTVLSLLLLFANMIDARKDLRDYWRIVVKNQDMPGESTQGLIPEDQASTVSKTT
AYCHTHEDSEHTMEKPFFNKNFELMPDVSIYDNGVKLTKQKAFVKDLELMPDVSIYDNGIKPKD
KQRSFAKNFELMPDVSIYDNGIKPTKQKAFAKHFEFLPDVSIYDNGIKPTKQKFFAKDFELMPD
VSIYDNGVKLAKQRFSAKDFELMPDVSIYNNGVELAKQKAFAKGFELMPDVSIYDNDIKPSKKS
SYAKDFELKADI
Repeat found in evm.model.chr8A.798
Repeat occurs 5 times in a sequence of 217 amino acids
Location between 4804515 and 4805488
Coverage of 29.95 %
Instances:
FELMPDISIYDNG | FELMPDLSIYDNG | FELMPDLSIYDNG | FELMPDVSIYDND | FELKADISIHEPT

pattern: FEL[KM][AP]D[ILV]SI[YH][ED][PN][DGT]
MNIKAFFVLSTVLSLLLLFANMIDARKDLGDNWSIVVKNQDIPGESTLGLVPEDQGSTISKTK
AYCHTHDDSEHTMEKPFVNKKFELMPDISIYDNGIKPTKQKAFAKNFELMPDLSIYDNGIKPTK
QKAFAKNFELMPDLSIYDNGIKPTKQKFFAKNFELMPDVSIYDNDIKPTKRSSYAKDFELKADI
SIHEPTEQKSVVSSTDLQPDATIYHN
Repeat found in evm.model.chr8A.819
Repeat occurs 5 times in a sequence of 195 amino acids
Location between 5014705 and 5015411
Coverage of 15.38 %
Instances:
ATIDIL | ATIYHN | ATIYHN | ATIYHN | ATIYHE

pattern: ATI[YD][IH][ELN]
MNLKAFFVLSAVLSLLLLFANRTEARKDQGEYWRGFVKDSDVPESIQIHARQDPVSTASNAKA
HCKEPEDLEHKREKTYVKDSDATIDILVYHNDIKPTEQKLFGNHFESSPDATIYHNDIKPTEQK
LFTNHFESSPDATIYHNDIKPTEQKLFANHFVSSPDATIYHNDIKPIEMIKSFVSKFLSNRDAT
IYHE

Similar gene clusters

No significant ClusterBlast hits found.

chr8_PeraB - Cluster 106 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr8_PeraB - Gene Cluster 106. Type = cyclopeptide. Location: 4525861 - 4885598 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
Repeat found in evm.model.chr8A.798
Repeat occurs 5 times in a sequence of 217 amino acids
Location between 4804515 and 4805488
Coverage of 29.95 %
Instances:
FELMPDISIYDNG | FELMPDLSIYDNG | FELMPDLSIYDNG | FELMPDVSIYDND | FELKADISIHEPT

pattern: FEL[KM][AP]D[ILV]SI[YH][ED][PN][DGT]
MNIKAFFVLSTVLSLLLLFANMIDARKDLGDNWSIVVKNQDIPGESTLGLVPEDQGSTISKTK
AYCHTHDDSEHTMEKPFVNKKFELMPDISIYDNGIKPTKQKAFAKNFELMPDLSIYDNGIKPTK
QKAFAKNFELMPDLSIYDNGIKPTKQKFFAKNFELMPDVSIYDNDIKPTKRSSYAKDFELKADI
SIHEPTEQKSVVSSTDLQPDATIYHN

Similar gene clusters

No significant ClusterBlast hits found.

chr8_PeraB - Cluster 107 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr8_PeraB - Gene Cluster 107. Type = cf_putative. Location: 5468232 - 5681720 nt. ClusterFinder probability: 0.9789. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8_PeraB - Cluster 108 - Lignan

Gene cluster description

Download cluster GenBank file
chr8_PeraB - Gene Cluster 108. Type = lignan. Location: 8471195 - 9002165 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8_PeraB - Cluster 109 - Polyketide

Gene cluster description

Download cluster GenBank file
chr8_PeraB - Gene Cluster 109. Type = polyketide. Location: 11216987 - 11631572 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8_PeraB - Cluster 110 - Saccharide

Gene cluster description

Download cluster GenBank file
chr8_PeraB - Gene Cluster 110. Type = saccharide. Location: 14125586 - 14542263 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraA - Cluster 111 - Alkaloid

Gene cluster description

Download cluster GenBank file
chr9_PeraA - Gene Cluster 111. Type = alkaloid. Location: 1461966 - 1554497 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraA - Cluster 112 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9_PeraA - Gene Cluster 112. Type = cf_putative. Location: 1731274 - 1806538 nt. ClusterFinder probability: 0.8820. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraA - Cluster 113 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9_PeraA - Gene Cluster 113. Type = cf_putative. Location: 3369906 - 3431405 nt. ClusterFinder probability: 0.7975. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraA - Cluster 114 - Alkaloid

Gene cluster description

Download cluster GenBank file
chr9_PeraA - Gene Cluster 114. Type = alkaloid. Location: 3653898 - 3807369 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraA - Cluster 115 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9_PeraA - Gene Cluster 115. Type = cf_putative. Location: 4545286 - 4766239 nt. ClusterFinder probability: 0.9853. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraA - Cluster 116 - Putative

Gene cluster description

Download cluster GenBank file
chr9_PeraA - Gene Cluster 116. Type = putative. Location: 5586161 - 5720139 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraA - Cluster 117 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9_PeraA - Gene Cluster 117. Type = cf_putative. Location: 6906123 - 7006085 nt. ClusterFinder probability: 0.9848. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraA - Cluster 118 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9_PeraA - Gene Cluster 118. Type = cf_putative. Location: 13922487 - 14417817 nt. ClusterFinder probability: 0.9702. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraA - Cluster 119 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9_PeraA - Gene Cluster 119. Type = cf_putative. Location: 20987436 - 21141988 nt. ClusterFinder probability: 0.9772. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraA - Cluster 120 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9_PeraA - Gene Cluster 120. Type = cf_putative. Location: 26777938 - 26872697 nt. ClusterFinder probability: 0.8963. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraB - Cluster 121 - Alkaloid

Gene cluster description

Download cluster GenBank file
chr9_PeraB - Gene Cluster 121. Type = alkaloid. Location: 1176499 - 1289756 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraB - Cluster 122 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9_PeraB - Gene Cluster 122. Type = cf_putative. Location: 1456674 - 1534242 nt. ClusterFinder probability: 0.9115. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraB - Cluster 123 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9_PeraB - Gene Cluster 123. Type = cf_putative. Location: 3043264 - 3100710 nt. ClusterFinder probability: 0.8058. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraB - Cluster 124 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9_PeraB - Gene Cluster 124. Type = cf_putative. Location: 4149020 - 4366112 nt. ClusterFinder probability: 0.9869. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraB - Cluster 125 - Putative

Gene cluster description

Download cluster GenBank file
chr9_PeraB - Gene Cluster 125. Type = putative. Location: 5312484 - 5418537 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraB - Cluster 126 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9_PeraB - Gene Cluster 126. Type = cf_putative. Location: 6534046 - 6743785 nt. ClusterFinder probability: 0.9762. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraB - Cluster 127 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9_PeraB - Gene Cluster 127. Type = cf_putative. Location: 15506140 - 15756620 nt. ClusterFinder probability: 0.9221. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraB - Cluster 128 - Saccharide

Gene cluster description

Download cluster GenBank file
chr9_PeraB - Gene Cluster 128. Type = saccharide. Location: 20100290 - 20427548 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraB - Cluster 129 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9_PeraB - Gene Cluster 129. Type = cf_putative. Location: 22939661 - 23135682 nt. ClusterFinder probability: 0.8889. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9_PeraB - Cluster 130 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9_PeraB - Gene Cluster 130. Type = cf_putative. Location: 28677433 - 28766625 nt. ClusterFinder probability: 0.8841. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.