Identified secondary metabolite clusters

Cluster Type From To Size (kb) Core domains Most similar known cluster MIBiG BGC-ID
The following clusters are from record scaffold_1:
Cluster 1Cf_putative25219492646961125.01--
Cluster 2Alkaloid3030512311461784.11Cu_amine_oxid, Epimerase, p450--
Cluster 3Cf_putative85097168631707121.99--
Cluster 4Alkaloid9004572906580261.23Cu_amine_oxid, p450--
Cluster 5Putative104516771052213370.46Transferase, p450--
Cluster 6Saccharide153261091538200455.90DAHP_synth_2, UDPGT_2--
Cluster 7Saccharide154131871543714623.96Transferase, UDPGT_2--
The following clusters are from record scaffold_2:
Cluster 8Alkaloid32211635478532.67AMP-binding, Str_synth--
Cluster 9Putative5621654570006078.41Aminotran_3, FA_desaturase_2, p450--
Cluster 10Cf_putative87660858964931198.85--
Cluster 11Cf_putative95386249722995184.37--
Cluster 12Saccharide159386021597860440.00Methyltransf_2, UDPGT_2--
The following clusters are from record scaffold_3:
Cluster 13Cf_putative69899187509950520.03--
Cluster 14Putative8183574828313899.562OG-FeII_Oxy, Aminotran_1_2, DIOX_N--
Cluster 15Cf_putative1056563010722135156.50--
Cluster 16Cf_putative131564231324535788.93--
Cluster 17Cyclopeptide1401412814285037270.91BURP--
Cluster 18Saccharide155603821559503334.65Epimerase, Glycos_transf_2, p450--
The following clusters are from record scaffold_4:
Cluster 19Saccharide42245074557053332.55AMP-binding, Lipoxygenase, UDPGT_2, p450--
Cluster 20Cyclopeptide58837496273833390.08BURP--
Cluster 21Saccharide103212281036031239.08UDPGT_2, p450--
Cluster 22Cf_putative109589151098843329.52--
Cluster 23Lignan-Polyketide111690801122415455.07Chal_sti_synt_C, Dirigent--
The following clusters are from record scaffold_6:
Cluster 24Saccharide5820872588450963.64AMP-binding, Cellulose_synt, UDPGT_2--
The following clusters are from record scaffold_7:
Cluster 25Saccharide5788253584478056.53Aminotran_1_2, Glycos_transf_2, SE--
Cluster 26Putative7146711719067543.96AMP-binding, Transferase--
Cluster 27Cf_putative7245476732447479.00--
The following clusters are from record scaffold_8:
Cluster 28Putative3162757320523342.48Peptidase_S10, p450--
Cluster 29Saccharide4331274435804326.77Transferase, UDPGT_2--
Cluster 30Saccharide4401420445736755.95DAHP_synth_2, UDPGT_2--
Cluster 31Putative6352832638531932.49COesterase, Peptidase_S10--
Cluster 32Cyclopeptide68323427014081181.74BURP--
Cluster 33Cf_putative70995727206091106.52--
Cluster 34Cyclopeptide90256109234446208.84BURP--
The following clusters are from record scaffold_9:
Cluster 35Terpene51983645465188266.82Terpene_synth, Terpene_synth_C, p450--
Cluster 36Terpene55103425639368129.03Terpene_synth, Terpene_synth_C, p450--
Cluster 37Cf_putative1284227913021139178.86--
Cluster 38Terpene1458113414685985104.85Epimerase, Terpene_synth, Terpene_synth_C--
The following clusters are from record scaffold_11:
Cluster 39Cf_putative29336163584373650.76--
Cluster 40Cyclopeptide44628364855477392.64BURP--
Cluster 41Putative4856939494889091.95Methyltransf_7, p450--
Cluster 42Saccharide8872675891547642.80AMP-binding, UDPGT_2--
Cluster 43Cf_putative9021912905891237.00--
Cluster 44Cf_putative97647569882644117.89--
Cluster 45Alkaloid107305111080026369.75Cu_amine_oxid, Lipoxygenase--
Cluster 46Cf_putative1129795111413316115.36--
Cluster 47Putative117915091186248070.972OG-FeII_Oxy, DIOX_N--
Cluster 48Cf_putative134966131352710930.50--
Cluster 49Cf_putative142550801426677611.70--
The following clusters are from record scaffold_12:
Cluster 50Putative40359749837794.78Acetyltransf_1, Amino_oxidase, Epimerase, Methyltransf_11--
Cluster 51Cyclopeptide1083539311161860326.47BURP--
Cluster 52Cf_putative1280767712932179124.50--
The following clusters are from record scaffold_13:
Cluster 53Putative39759944208761232.77COesterase, Transferase, p450--
Cluster 54Cyclopeptide53007485890660589.91BURP--
The following clusters are from record scaffold_14:
Cluster 55Terpene1359576145762598.05Epimerase, Terpene_synth, Terpene_synth_C--
Cluster 56Cf_putative3923986397565351.67--
Cluster 57Putative86281729048285420.11Aminotran_1_2, DIOX_N--
The following clusters are from record scaffold_15:
Cluster 58Cf_putative1854635190778953.15--
Cluster 59Cf_putative46599774830734170.76--
The following clusters are from record scaffold_17:
Cluster 60Terpene16774751929210251.74SQHop_cyclase_C, SQHop_cyclase_N, p450--
Cluster 61Cf_putative5150957518042929.47--
The following clusters are from record scaffold_18:
Cluster 62Putative19092122266565357.35HMGL-like, Peptidase_S10, Transferase, adh_short_C2--
The following clusters are from record scaffold_27:
Cluster 63Terpene22926052444456151.85Terpene_synth, Terpene_synth_C--
The following clusters are from record scaffold_28:
Cluster 64Cf_putative36202444652484.50--
Cluster 65Saccharide70256273504932.49UDPGT_2, p450--
The following clusters are from record scaffold_32:
Cluster 66Saccharide11576417794762.18AMP-binding, UDPGT_2, p450--
Cluster 67Cf_putative280306444551164.25--
The following clusters are from record scaffold_236:
Cluster 68Cf_putative12472459723.35--
The following clusters are from record scaffold_320:
Cluster 69Cf_putative131573415.72--
The following clusters are from record scaffold_558:
Cluster 70Cf_putative9741738216.41--

scaffold_1 - Cluster 1 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_1 - Gene Cluster 1. Type = cf_putative. Location: 2521949 - 2646961 nt. ClusterFinder probability: 0.9419. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_1 - Cluster 2 - Alkaloid

Gene cluster description

Download cluster GenBank file
scaffold_1 - Gene Cluster 2. Type = alkaloid. Location: 3030512 - 3114617 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_1 - Cluster 3 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_1 - Gene Cluster 3. Type = cf_putative. Location: 8509716 - 8631707 nt. ClusterFinder probability: 0.9348. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_1 - Cluster 4 - Alkaloid

Gene cluster description

Download cluster GenBank file
scaffold_1 - Gene Cluster 4. Type = alkaloid. Location: 9004572 - 9065802 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_1 - Cluster 5 - Putative

Gene cluster description

Download cluster GenBank file
scaffold_1 - Gene Cluster 5. Type = putative. Location: 10451677 - 10522133 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_1 - Cluster 6 - Saccharide

Gene cluster description

Download cluster GenBank file
scaffold_1 - Gene Cluster 6. Type = saccharide. Location: 15326109 - 15382004 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_1 - Cluster 7 - Saccharide

Gene cluster description

Download cluster GenBank file
scaffold_1 - Gene Cluster 7. Type = saccharide. Location: 15413187 - 15437146 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_2 - Cluster 8 - Alkaloid

Gene cluster description

Download cluster GenBank file
scaffold_2 - Gene Cluster 8. Type = alkaloid. Location: 322116 - 354785 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_2 - Cluster 9 - Putative

Gene cluster description

Download cluster GenBank file
scaffold_2 - Gene Cluster 9. Type = putative. Location: 5621654 - 5700060 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_2 - Cluster 10 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_2 - Gene Cluster 10. Type = cf_putative. Location: 8766085 - 8964931 nt. ClusterFinder probability: 0.9947. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_2 - Cluster 11 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_2 - Gene Cluster 11. Type = cf_putative. Location: 9538624 - 9722995 nt. ClusterFinder probability: 0.9309. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_2 - Cluster 12 - Saccharide

Gene cluster description

Download cluster GenBank file
scaffold_2 - Gene Cluster 12. Type = saccharide. Location: 15938602 - 15978604 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_3 - Cluster 13 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_3 - Gene Cluster 13. Type = cf_putative. Location: 6989918 - 7509950 nt. ClusterFinder probability: 0.9057. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_3 - Cluster 14 - Putative

Gene cluster description

Download cluster GenBank file
scaffold_3 - Gene Cluster 14. Type = putative. Location: 8183574 - 8283138 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_3 - Cluster 15 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_3 - Gene Cluster 15. Type = cf_putative. Location: 10565630 - 10722135 nt. ClusterFinder probability: 0.9166. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_3 - Cluster 16 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_3 - Gene Cluster 16. Type = cf_putative. Location: 13156423 - 13245357 nt. ClusterFinder probability: 0.8846. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_3 - Cluster 17 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
scaffold_3 - Gene Cluster 17. Type = cyclopeptide. Location: 14014128 - 14285037 nt. ClusterFinder probability: 0.7365. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_3 - Cluster 18 - Saccharide

Gene cluster description

Download cluster GenBank file
scaffold_3 - Gene Cluster 18. Type = saccharide. Location: 15560382 - 15595033 nt. ClusterFinder probability: 0.9506. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_4 - Cluster 19 - Saccharide

Gene cluster description

Download cluster GenBank file
scaffold_4 - Gene Cluster 19. Type = saccharide. Location: 4224507 - 4557053 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_4 - Cluster 20 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
scaffold_4 - Gene Cluster 20. Type = cyclopeptide. Location: 5883749 - 6273833 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_4 - Cluster 21 - Saccharide

Gene cluster description

Download cluster GenBank file
scaffold_4 - Gene Cluster 21. Type = saccharide. Location: 10321228 - 10360312 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_4 - Cluster 22 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_4 - Gene Cluster 22. Type = cf_putative. Location: 10958915 - 10988433 nt. ClusterFinder probability: 0.7768. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_4 - Cluster 23 - Lignan-polyketide

Gene cluster description

Download cluster GenBank file
scaffold_4 - Gene Cluster 23. Type = lignan-polyketide. Location: 11169080 - 11224154 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_6 - Cluster 24 - Saccharide

Gene cluster description

Download cluster GenBank file
scaffold_6 - Gene Cluster 24. Type = saccharide. Location: 5820872 - 5884509 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_7 - Cluster 25 - Saccharide

Gene cluster description

Download cluster GenBank file
scaffold_7 - Gene Cluster 25. Type = saccharide. Location: 5788253 - 5844780 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_7 - Cluster 26 - Putative

Gene cluster description

Download cluster GenBank file
scaffold_7 - Gene Cluster 26. Type = putative. Location: 7146711 - 7190675 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_7 - Cluster 27 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_7 - Gene Cluster 27. Type = cf_putative. Location: 7245476 - 7324474 nt. ClusterFinder probability: 0.9612. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_8 - Cluster 28 - Putative

Gene cluster description

Download cluster GenBank file
scaffold_8 - Gene Cluster 28. Type = putative. Location: 3162757 - 3205233 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_8 - Cluster 29 - Saccharide

Gene cluster description

Download cluster GenBank file
scaffold_8 - Gene Cluster 29. Type = saccharide. Location: 4331274 - 4358043 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_8 - Cluster 30 - Saccharide

Gene cluster description

Download cluster GenBank file
scaffold_8 - Gene Cluster 30. Type = saccharide. Location: 4401420 - 4457367 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_8 - Cluster 31 - Putative

Gene cluster description

Download cluster GenBank file
scaffold_8 - Gene Cluster 31. Type = putative. Location: 6352832 - 6385319 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_8 - Cluster 32 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
scaffold_8 - Gene Cluster 32. Type = cyclopeptide. Location: 6832342 - 7014081 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
The following known motifs were found in CDS evm.model.scaffold_8.1054
Location between 6929568 and 6930862
FEPR was found 7 times in this sequence
Sequence:
MKSFLSLSAFFLSLLLWLQLQLFLFSHSAQFANTIAARTDPVEYWRAIMKDEPMAEAIQGLLR
IDAAASSFSDEKPDCHDADQSFAPQKEKTFVKDFEPGHRATAYDNDIKPAEEKSFFKDFNPRSS
GEKSSFANDFEPRPSVTAYTDDVGLKGKKLSSFAKSFDPKPSATAYTHDIGSKEKLSSANDFEP
RPGVPACTDDVGLREKKLSFANDFEPRPGVTAYTDDVGLKENKLAFAKDFEPRPSATAYVDDVG
LKKKKLAFANDFEPRPSATAYVDDVGLKKKKLAFAKDFEPRPSATAYVDDVGLKKKKLTFAKDF
EPRPSATAYTDDVGLKKKLSFVNDFTPRPSVAVDTDNVDL

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_8 - Cluster 33 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_8 - Gene Cluster 33. Type = cf_putative. Location: 7099572 - 7206091 nt. ClusterFinder probability: 0.9610. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_8 - Cluster 34 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
scaffold_8 - Gene Cluster 34. Type = cyclopeptide. Location: 9025610 - 9234446 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_9 - Cluster 35 - Terpene

Gene cluster description

Download cluster GenBank file
scaffold_9 - Gene Cluster 35. Type = terpene. Location: 5198364 - 5465188 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_9 - Cluster 36 - Terpene

Gene cluster description

Download cluster GenBank file
scaffold_9 - Gene Cluster 36. Type = terpene. Location: 5510342 - 5639368 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_9 - Cluster 37 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_9 - Gene Cluster 37. Type = cf_putative. Location: 12842279 - 13021139 nt. ClusterFinder probability: 0.8572. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_9 - Cluster 38 - Terpene

Gene cluster description

Download cluster GenBank file
scaffold_9 - Gene Cluster 38. Type = terpene. Location: 14581134 - 14685985 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_11 - Cluster 39 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_11 - Gene Cluster 39. Type = cf_putative. Location: 2933616 - 3584373 nt. ClusterFinder probability: 0.9864. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_11 - Cluster 40 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
scaffold_11 - Gene Cluster 40. Type = cyclopeptide. Location: 4462836 - 4855477 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_11 - Cluster 41 - Putative

Gene cluster description

Download cluster GenBank file
scaffold_11 - Gene Cluster 41. Type = putative. Location: 4856939 - 4948890 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_11 - Cluster 42 - Saccharide

Gene cluster description

Download cluster GenBank file
scaffold_11 - Gene Cluster 42. Type = saccharide. Location: 8872675 - 8915476 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_11 - Cluster 43 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_11 - Gene Cluster 43. Type = cf_putative. Location: 9021912 - 9058912 nt. ClusterFinder probability: 0.9972. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_11 - Cluster 44 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_11 - Gene Cluster 44. Type = cf_putative. Location: 9764756 - 9882644 nt. ClusterFinder probability: 0.8378. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_11 - Cluster 45 - Alkaloid

Gene cluster description

Download cluster GenBank file
scaffold_11 - Gene Cluster 45. Type = alkaloid. Location: 10730511 - 10800263 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_11 - Cluster 46 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_11 - Gene Cluster 46. Type = cf_putative. Location: 11297951 - 11413316 nt. ClusterFinder probability: 0.9710. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_11 - Cluster 47 - Putative

Gene cluster description

Download cluster GenBank file
scaffold_11 - Gene Cluster 47. Type = putative. Location: 11791509 - 11862480 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_11 - Cluster 48 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_11 - Gene Cluster 48. Type = cf_putative. Location: 13496613 - 13527109 nt. ClusterFinder probability: 0.8588. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_11 - Cluster 49 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_11 - Gene Cluster 49. Type = cf_putative. Location: 14255080 - 14266776 nt. ClusterFinder probability: 0.9587. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_12 - Cluster 50 - Putative

Gene cluster description

Download cluster GenBank file
scaffold_12 - Gene Cluster 50. Type = putative. Location: 403597 - 498377 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_12 - Cluster 51 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
scaffold_12 - Gene Cluster 51. Type = cyclopeptide. Location: 10835393 - 11161860 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
Repeat found in evm.model.scaffold_12.1472
Repeat occurs 3 times in a sequence of 167 amino acids
Location between 11014493 and 11014997
Coverage of 10.78 %
Instances:
GGGGCH | GGGCHG | GGGCHG |
pattern: GGG[CG][HC][HG]
MHLKLPGLPPPAREVAHGELVPGAQPHTEAPYQVAPPRSAHGSEDAASLGGGGCHGSLNRSPT
HGSEDAASLSGGGCHGPQSKPTRRPKRVPAQSRPTWRPKRVPAQSSHTRGAQKGCGPRRGAAGK
FKFSLPTEFLEPSKTLEGNLLGGEYFELKTLEGNLLGGIL

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_12 - Cluster 52 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_12 - Gene Cluster 52. Type = cf_putative. Location: 12807677 - 12932179 nt. ClusterFinder probability: 0.7685. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_13 - Cluster 53 - Putative

Gene cluster description

Download cluster GenBank file
scaffold_13 - Gene Cluster 53. Type = putative. Location: 3975994 - 4208761 nt. ClusterFinder probability: 0.9850. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_13 - Cluster 54 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
scaffold_13 - Gene Cluster 54. Type = cyclopeptide. Location: 5300748 - 5890660 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_14 - Cluster 55 - Terpene

Gene cluster description

Download cluster GenBank file
scaffold_14 - Gene Cluster 55. Type = terpene. Location: 1359576 - 1457625 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_14 - Cluster 56 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_14 - Gene Cluster 56. Type = cf_putative. Location: 3923986 - 3975653 nt. ClusterFinder probability: 0.9498. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_14 - Cluster 57 - Putative

Gene cluster description

Download cluster GenBank file
scaffold_14 - Gene Cluster 57. Type = putative. Location: 8628172 - 9048285 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_15 - Cluster 58 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_15 - Gene Cluster 58. Type = cf_putative. Location: 1854635 - 1907789 nt. ClusterFinder probability: 0.9677. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_15 - Cluster 59 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_15 - Gene Cluster 59. Type = cf_putative. Location: 4659977 - 4830734 nt. ClusterFinder probability: 0.9972. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_17 - Cluster 60 - Terpene

Gene cluster description

Download cluster GenBank file
scaffold_17 - Gene Cluster 60. Type = terpene. Location: 1677475 - 1929210 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_17 - Cluster 61 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_17 - Gene Cluster 61. Type = cf_putative. Location: 5150957 - 5180429 nt. ClusterFinder probability: 0.9348. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_18 - Cluster 62 - Putative

Gene cluster description

Download cluster GenBank file
scaffold_18 - Gene Cluster 62. Type = putative. Location: 1909212 - 2266565 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_27 - Cluster 63 - Terpene

Gene cluster description

Download cluster GenBank file
scaffold_27 - Gene Cluster 63. Type = terpene. Location: 2292605 - 2444456 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_28 - Cluster 64 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_28 - Gene Cluster 64. Type = cf_putative. Location: 362024 - 446524 nt. ClusterFinder probability: 0.8274. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_28 - Cluster 65 - Saccharide

Gene cluster description

Download cluster GenBank file
scaffold_28 - Gene Cluster 65. Type = saccharide. Location: 702562 - 735049 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_32 - Cluster 66 - Saccharide

Gene cluster description

Download cluster GenBank file
scaffold_32 - Gene Cluster 66. Type = saccharide. Location: 115764 - 177947 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_32 - Cluster 67 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_32 - Gene Cluster 67. Type = cf_putative. Location: 280306 - 444551 nt. ClusterFinder probability: 0.9451. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_236 - Cluster 68 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_236 - Gene Cluster 68. Type = cf_putative. Location: 1247 - 24597 nt. ClusterFinder probability: 0.9897. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_320 - Cluster 69 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_320 - Gene Cluster 69. Type = cf_putative. Location: 13 - 15734 nt. ClusterFinder probability: 0.9094. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

scaffold_558 - Cluster 70 - Cf_putative

Gene cluster description

Download cluster GenBank file
scaffold_558 - Gene Cluster 70. Type = cf_putative. Location: 974 - 17382 nt. ClusterFinder probability: 0.8364. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.