Identified secondary metabolite clusters

Cluster Type From To Size (kb) Core domains Most similar known cluster MIBiG BGC-ID
The following clusters are from record chr1:
Cluster 1Putative1312277137400961.73Methyltransf_7, p450--
Cluster 2Saccharide1825852189017464.32UDPGT_2, polyprenyl_synt--
Cluster 3Putative2828625288230753.68Methyltransf_3, Transferase--
Cluster 4Cf_putative3765778380806842.29--
Cluster 5Putative5861662593376872.11Aminotran_3, FA_desaturase_2, p450--
Cluster 6Cf_putative96324359802295169.86--
Cluster 7Saccharide1070215910875318173.16DIOX_N, Epimerase, UDPGT_2--
Cluster 8Putative368098743690344493.57Acetyltransf_1, Amino_oxidase, Epimerase, Methyltransf_11--
The following clusters are from record chr2:
Cluster 9Saccharide1596372164794551.57AMP-binding, UDPGT_2, p450--
Cluster 10Cyclopeptide18648832012842147.96BURP--
Cluster 11Cyclopeptide42672714425771158.50BURP--
Cluster 12Saccharide7075258713587260.61Transferase, UDPGT_2--
Cluster 13Putative8439974848350343.53Peptidase_S10, p450--
Cluster 14Cf_putative1037315210747202374.05--
Cluster 15Cyclopeptide3158282032370152787.33BURP--
Cluster 16Cf_putative3396014634415903455.76--
The following clusters are from record chr3:
Cluster 17Cyclopeptide490784735624244.84BURP--
Cluster 18Alkaloid331272133320384676.63Cu_amine_oxid, Epimerase, p450--
Cluster 19Cf_putative3359667233702362105.69--
Cluster 20Saccharide3567467036007683333.01Epimerase, UDPGT_2--
The following clusters are from record chr4:
Cluster 21Cf_putative16731100182714541540.35--
Cluster 22Cyclopeptide1987499820419987544.99BURP--
Cluster 23Cf_putative258306602586953638.88--
Cluster 24Cf_putative2667587326809714133.84--
Cluster 25Cf_putative2836777928525023157.24--
Cluster 26Putative289376862901605478.372OG-FeII_Oxy, DIOX_N--
Cluster 27Cf_putative2943562029537929102.31--
Cluster 28Cf_putative307716433080236430.72--
Cluster 29Cf_putative315219083153465912.75--
The following clusters are from record chr5:
Cluster 30Saccharide38054743971602166.13Methyltransf_2, UDPGT_2--
Cluster 31Saccharide319771743204482967.66AMP-binding, Cellulose_synt, UDPGT_2--
The following clusters are from record chr6:
Cluster 32Terpene59946526156851162.20Prenyltrans, SQHop_cyclase_C, SQHop_cyclase_N, p450--
Cluster 33Cf_putative220940382214583351.80--
Cluster 34Terpene247099862479965989.67Epimerase, Terpene_synth, Terpene_synth_C--
The following clusters are from record chr7:
Cluster 35Terpene31038633251892148.03Epimerase, Terpene_synth, Terpene_synth_C--
Cluster 36Cf_putative82632908565917302.63--
Cluster 37Terpene14540171176612243121.05Terpene_synth, Terpene_synth_C, p450--
The following clusters are from record chr8:
Cluster 38Cf_putative37888047157292.69--
Cluster 39Cf_putative12883071458000169.69--
Cluster 40Cf_putative2466147254841082.26--
Cluster 41Saccharide4035427409333757.91Aminotran_1_2, Glycos_transf_2, SE--
The following clusters are from record chr9:
Cluster 42Saccharide44410147866234.56Epimerase, Glycos_transf_2, p450--
Cluster 43Putative1437177147248335.31Peptidase_S10, Transferase--
Cluster 44Cyclopeptide18146272085395270.77BURP--
Cluster 45Cf_putative55463875698865152.48--
Cluster 46Putative83500278515908165.882OG-FeII_Oxy, Aminotran_1_2, DIOX_N, Lipoxygenase, p450--
Cluster 47Cf_putative932627610239475913.20--
Cluster 48Cyclopeptide3005793330630014572.08BURP--
Cluster 49Cyclopeptide3007596330442935366.97BURP--
Cluster 50Saccharide358228003587439651.60UDPGT_2, p450--
Cluster 51Cf_putative365013353652832626.99--
Cluster 52Cf_putative3807990838256356176.45--
The following clusters are from record chr10:
Cluster 53Cf_putative5887765594131653.55--

chr1 - Cluster 1 - Putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 1. Type = putative. Location: 1312277 - 1374009 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 2 - Saccharide

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 2. Type = saccharide. Location: 1825852 - 1890174 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 3 - Putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 3. Type = putative. Location: 2828625 - 2882307 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 4 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 4. Type = cf_putative. Location: 3765778 - 3808068 nt. ClusterFinder probability: 0.9703. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 5 - Putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 5. Type = putative. Location: 5861662 - 5933768 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 6 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 6. Type = cf_putative. Location: 9632435 - 9802295 nt. ClusterFinder probability: 0.9711. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 7 - Saccharide

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 7. Type = saccharide. Location: 10702159 - 10875318 nt. ClusterFinder probability: 0.7748. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 8 - Putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 8. Type = putative. Location: 36809874 - 36903444 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 9 - Saccharide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 9. Type = saccharide. Location: 1596372 - 1647945 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 10 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 10. Type = cyclopeptide. Location: 1864883 - 2012842 nt. ClusterFinder probability: 0.8968. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 11 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 11. Type = cyclopeptide. Location: 4267271 - 4425771 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
The following known motifs were found in CDS evm.model.chr2.959
Location between 4337698 and 4339020
FEPR was found 6 times in this sequence
VS[AI]Y was found 3 times in this sequence
Sequence:
MKSFLSLFAFFLSLLLFANTIAARTDPGEYWRAIMKDEPMPEAIEGLLRIDAAASSFSDEKPN
CHDADQSFEPQKEKTFVKDFEPGHGATAYDNDIKPAEEKSFVKDFNPRSTGEKSSFANDFEQRP
SATAHTDDVGLKEKKLSSFAKSFEPKPSATAYTDDVGSKEKLSIANDFEPRPSVTTYTDNVDLK
EEKLAFVNDFEPRPSATAYTDDVGLREKKLSFANDFEPRPGVTAYTDDVGLKEKKLAFAKDFEP
RPSVTTYVDDVGLKEKKLFANDFEPRPSVSAYTDDVGLKKKKLAFANDFEPRPSVSAYTDDVGL
KKKELSFANDFKPRPSVSAYTDNVDLKKKKQFVSDF
The following known motifs were found in CDS evm.model.chr2.958
Location between 4331190 and 4331625
FEPR was found 2 times in this sequence
Sequence:
MQIANTIAAARKDAGEYWRAVMREQAMPEAIEALVRIDAATSSKEKTDCHTPTSFELKEEKIL
VEAFEPRPNEGEKKSFADYFEPRPNVSAYGDDADLKAEKSSSFTKDRPSIPAYGDDAGLKGEKK
SFVSDFEPGPNITVYHD

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 12 - Saccharide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 12. Type = saccharide. Location: 7075258 - 7135872 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 13 - Putative

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 13. Type = putative. Location: 8439974 - 8483503 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 14 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 14. Type = cf_putative. Location: 10373152 - 10747202 nt. ClusterFinder probability: 0.8582. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 15 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 15. Type = cyclopeptide. Location: 31582820 - 32370152 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
Repeat found in ___NO_NAME_ASSIGNED___
Repeat occurs 5 times in a sequence of 129 amino acids
Location between 32194043 and 32194433
Coverage of 23.26 %
Instances:
GSPFPG | GSPFPG | GSPCSG | GSPFPG | GSPWPG

pattern: GSP[CWF][PS]G
MSPCPGILNPVGSPFPGILNPAGSPFPGILIPLGSPCSGILNPLGSPFPGILNPLLGSPWPGG
LAAGFLPSNPNSMSLSLGRMVWFWFRLEGFVWLMRRLQSLPRKQAIADITTITASTIKTVPNDP
FE

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 16 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 16. Type = cf_putative. Location: 33960146 - 34415903 nt. ClusterFinder probability: 0.9943. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 17 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 17. Type = cyclopeptide. Location: 490784 - 735624 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 18 - Alkaloid

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 18. Type = alkaloid. Location: 33127213 - 33203846 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 19 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 19. Type = cf_putative. Location: 33596672 - 33702362 nt. ClusterFinder probability: 0.9882. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 20 - Saccharide

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 20. Type = saccharide. Location: 35674670 - 36007683 nt. ClusterFinder probability: 0.9133. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 21 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 21. Type = cf_putative. Location: 16731100 - 18271454 nt. ClusterFinder probability: 0.9610. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 22 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 22. Type = cyclopeptide. Location: 19874998 - 20419987 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
Repeat found in evm.model.chr4.1972
Repeat occurs 7 times in a sequence of 489 amino acids
Location between 20146692 and 20148292
Coverage of 8.59 %
Instances:
KYKPSY | KYKPDY | KYKPGY | KYKPGY | KYKAGY
KYKPGY | KYKPGY |
pattern: KYK[AP][SDG]Y
MVLRFIYSVLLLCLLLLTCDHGDAVKDLKEKHCDEEEGKTSSLSSYIARLESKYKPSYVVYET
DEKIARLESKYKPDYGVDETEGKSSSPSSYIAHLESKYKPGYVVDEVDEKIACLESKYKPGYGV
DEIEKKSSSPSSYIARLESKYKAGYVVDEAEEKIARLESRYKPGYGVDEAKEKSSFQSSYITRL
ENKYKPGYVADETAEKSSSLRSYITDLGSKYKPGYIDDQAEEKSLSQPSSKMMEHHSMENHGDD
DIGSEEVGVFTIDDVRAFHVGRKLSTFFSIRNPSLYPGFLPREMADSIPFSSSETSKILQFFSV
SPESPKGKAIKDTLRRCEIEPAKGETKICSTSSESMLEFLKNAFGEANFKLISTSHPTMTTPIL
QSYTILEPPREIESPKKVACHPLQYLYAIYMCHYDATETKIFKVPLVGDNGDKVDALIVCHMDT
SAWSPKHTAFSLLGTKPGIPVCHAFSEGHGVWIESSIPVATI

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 23 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 23. Type = cf_putative. Location: 25830660 - 25869536 nt. ClusterFinder probability: 0.9972. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 24 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 24. Type = cf_putative. Location: 26675873 - 26809714 nt. ClusterFinder probability: 0.8528. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 25 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 25. Type = cf_putative. Location: 28367779 - 28525023 nt. ClusterFinder probability: 0.9724. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 26 - Putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 26. Type = putative. Location: 28937686 - 29016054 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 27 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 27. Type = cf_putative. Location: 29435620 - 29537929 nt. ClusterFinder probability: 0.9784. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 28 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 28. Type = cf_putative. Location: 30771643 - 30802364 nt. ClusterFinder probability: 0.7853. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 29 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 29. Type = cf_putative. Location: 31521908 - 31534659 nt. ClusterFinder probability: 0.8989. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5 - Cluster 30 - Saccharide

Gene cluster description

Download cluster GenBank file
chr5 - Gene Cluster 30. Type = saccharide. Location: 3805474 - 3971602 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5 - Cluster 31 - Saccharide

Gene cluster description

Download cluster GenBank file
chr5 - Gene Cluster 31. Type = saccharide. Location: 31977174 - 32044829 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6 - Cluster 32 - Terpene

Gene cluster description

Download cluster GenBank file
chr6 - Gene Cluster 32. Type = terpene. Location: 5994652 - 6156851 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6 - Cluster 33 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr6 - Gene Cluster 33. Type = cf_putative. Location: 22094038 - 22145833 nt. ClusterFinder probability: 0.9517. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6 - Cluster 34 - Terpene

Gene cluster description

Download cluster GenBank file
chr6 - Gene Cluster 34. Type = terpene. Location: 24709986 - 24799659 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7 - Cluster 35 - Terpene

Gene cluster description

Download cluster GenBank file
chr7 - Gene Cluster 35. Type = terpene. Location: 3103863 - 3251892 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7 - Cluster 36 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr7 - Gene Cluster 36. Type = cf_putative. Location: 8263290 - 8565917 nt. ClusterFinder probability: 0.8825. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7 - Cluster 37 - Terpene

Gene cluster description

Download cluster GenBank file
chr7 - Gene Cluster 37. Type = terpene. Location: 14540171 - 17661224 nt. ClusterFinder probability: 0.8684. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8 - Cluster 38 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr8 - Gene Cluster 38. Type = cf_putative. Location: 378880 - 471572 nt. ClusterFinder probability: 0.8370. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8 - Cluster 39 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr8 - Gene Cluster 39. Type = cf_putative. Location: 1288307 - 1458000 nt. ClusterFinder probability: 0.9367. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8 - Cluster 40 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr8 - Gene Cluster 40. Type = cf_putative. Location: 2466147 - 2548410 nt. ClusterFinder probability: 0.9313. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8 - Cluster 41 - Saccharide

Gene cluster description

Download cluster GenBank file
chr8 - Gene Cluster 41. Type = saccharide. Location: 4035427 - 4093337 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 42 - Saccharide

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 42. Type = saccharide. Location: 444101 - 478662 nt. ClusterFinder probability: 0.9501. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 43 - Putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 43. Type = putative. Location: 1437177 - 1472483 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 44 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 44. Type = cyclopeptide. Location: 1814627 - 2085395 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 45 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 45. Type = cf_putative. Location: 5546387 - 5698865 nt. ClusterFinder probability: 0.9260. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 46 - Putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 46. Type = putative. Location: 8350027 - 8515908 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 47 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 47. Type = cf_putative. Location: 9326276 - 10239475 nt. ClusterFinder probability: 0.8829. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 48 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 48. Type = cyclopeptide. Location: 30057933 - 30630014 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 49 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 49. Type = cyclopeptide. Location: 30075963 - 30442935 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 50 - Saccharide

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 50. Type = saccharide. Location: 35822800 - 35874396 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 51 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 51. Type = cf_putative. Location: 36501335 - 36528326 nt. ClusterFinder probability: 0.8079. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 52 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 52. Type = cf_putative. Location: 38079908 - 38256356 nt. ClusterFinder probability: 0.8783. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr10 - Cluster 53 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr10 - Gene Cluster 53. Type = cf_putative. Location: 5887765 - 5941316 nt. ClusterFinder probability: 0.9975. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.