Identified secondary metabolite clusters

Cluster Type From To Size (kb) Core domains Most similar known cluster MIBiG BGC-ID
The following clusters are from record chr10:
Cluster 1Putative12424881395093152.60Methyltransf_7, Transferase--
Cluster 2Putative5131217523068799.47Peptidase_S10, Transferase--
Cluster 3Cf_putative6235751628238646.63--
The following clusters are from record chr1:
Cluster 4Putative1312828137189059.06Methyltransf_7, p450--
Cluster 5Saccharide1821311188615664.84UDPGT_2, polyprenyl_synt--
Cluster 6Cf_putative3796035383675340.72--
Cluster 7Cf_putative984491710055233210.32--
Cluster 8Saccharide1099157211154690163.12DIOX_N, Epimerase, UDPGT_2--
Cluster 9Saccharide1169960811898023198.41Cellulose_synt, UDPGT_2--
Cluster 10Putative3918657739297631111.05Acetyltransf_1, Amino_oxidase, Epimerase, Methyltransf_11--
The following clusters are from record chr2:
Cluster 11Saccharide1661429170976148.33AMP-binding, UDPGT_2, p450--
Cluster 12Cf_putative18179951920464102.47--
Cluster 13Cyclopeptide19246012106393181.79BURP--
Cluster 14Cf_putative41883014298395110.09--
Cluster 15Cyclopeptide44130224582362169.34BURP--
Cluster 16Saccharide69811097123472142.36DAHP_synth_2, Prenyltransf, UDPGT_2--
Cluster 17Saccharide7296443735772161.28Transferase, UDPGT_2--
Cluster 18Putative8678971872116542.19Peptidase_S10, p450--
Cluster 19Cyclopeptide3299518033616058620.88BURP--
The following clusters are from record chr3:
Cluster 20Cyclopeptide497252752949255.70BURP--
Cluster 21Alkaloid320657123214921283.50Cu_amine_oxid, Epimerase, p450--
Cluster 22Cf_putative3256261732668195105.58--
Cluster 23Saccharide348826893490564322.95Epimerase, UDPGT_2--
The following clusters are from record chr4:
Cluster 24Cyclopeptide2178663222356747570.12BURP--
Cluster 25Cf_putative284122212845141039.19--
Cluster 26Cf_putative2929942629427312127.89--
Cluster 27Alkaloid3034746030478760131.30Cu_amine_oxid, Lipoxygenase--
Cluster 28Cf_putative3099786231157037159.18--
Cluster 29Putative315803423165816777.832OG-FeII_Oxy, DIOX_N--
Cluster 30Cf_putative3207770832192655114.95--
Cluster 31Cf_putative333964333342723430.80--
Cluster 32Cf_putative341512973416396312.67--
The following clusters are from record chr5:
Cluster 33Saccharide39191784075295156.12Methyltransf_11, Methyltransf_2, UDPGT_2--
Cluster 34Saccharide335041523357107166.92AMP-binding, Cellulose_synt, UDPGT_2--
The following clusters are from record chr6:
Cluster 35Cf_putative60843864928940.85--
Cluster 36Terpene65655856735973170.39Prenyltrans, SQHop_cyclase_C, SQHop_cyclase_N, p450--
Cluster 37Cf_putative233033572335518451.83--
Cluster 38Terpene260283212610801779.70Epimerase, Terpene_synth, Terpene_synth_C--
The following clusters are from record chr7:
Cluster 39Terpene30775903235028157.44Epimerase, Terpene_synth, Terpene_synth_C--
Cluster 40Terpene13805210172469813441.77Terpene_synth, Terpene_synth_C, p450--
The following clusters are from record chr8:
Cluster 41Cf_putative40069549087290.18--
Cluster 42Cf_putative13265411496282169.74--
Cluster 43Cf_putative2509374259089681.52--
Cluster 44Saccharide4062653412041157.76Aminotran_1_2, Glycos_transf_2, SE--
The following clusters are from record chr9:
Cluster 45Saccharide42172445620834.48Epimerase, Glycos_transf_2, p450--
Cluster 46Cyclopeptide17922362081806289.57BURP--
Cluster 47Cf_putative55903675742696152.33--
Cluster 48Putative84352038594643159.442OG-FeII_Oxy, Aminotran_1_2, DIOX_N, Lipoxygenase--
Cluster 49Cf_putative967110210473620802.52--
Cluster 50Cyclopeptide3363163834118909487.27BURP--
Cluster 51Cyclopeptide3369338834205175511.79BURP--
Cluster 52Saccharide395050033955538650.38UDPGT_2, p450--
Cluster 53Putative396616803974512583.44adh_short, adh_short_C2--
Cluster 54Cf_putative401934704022052327.05--
Cluster 55Lignan-Polyketide403750944043531960.23Chal_sti_synt_C, Dirigent, p450--
Cluster 56Cf_putative4179658841973600177.01--

chr10 - Cluster 1 - Putative

Gene cluster description

Download cluster GenBank file
chr10 - Gene Cluster 1. Type = putative. Location: 1242488 - 1395093 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr10 - Cluster 2 - Putative

Gene cluster description

Download cluster GenBank file
chr10 - Gene Cluster 2. Type = putative. Location: 5131217 - 5230687 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr10 - Cluster 3 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr10 - Gene Cluster 3. Type = cf_putative. Location: 6235751 - 6282386 nt. ClusterFinder probability: 0.9975. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 4 - Putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 4. Type = putative. Location: 1312828 - 1371890 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 5 - Saccharide

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 5. Type = saccharide. Location: 1821311 - 1886156 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 6 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 6. Type = cf_putative. Location: 3796035 - 3836753 nt. ClusterFinder probability: 0.9703. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 7 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 7. Type = cf_putative. Location: 9844917 - 10055233 nt. ClusterFinder probability: 0.9699. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 8 - Saccharide

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 8. Type = saccharide. Location: 10991572 - 11154690 nt. ClusterFinder probability: 0.8351. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 9 - Saccharide

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 9. Type = saccharide. Location: 11699608 - 11898023 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 10 - Putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 10. Type = putative. Location: 39186577 - 39297631 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 11 - Saccharide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 11. Type = saccharide. Location: 1661429 - 1709761 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 12 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 12. Type = cf_putative. Location: 1817995 - 1920464 nt. ClusterFinder probability: 0.9570. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 13 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 13. Type = cyclopeptide. Location: 1924601 - 2106393 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 14 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 14. Type = cf_putative. Location: 4188301 - 4298395 nt. ClusterFinder probability: 0.9012. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 15 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 15. Type = cyclopeptide. Location: 4413022 - 4582362 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
The following known motifs were found in CDS evm.model.chr2.935
Location between 4488877 and 4490199
FEPR was found 7 times in this sequence
VS[AI]Y was found 3 times in this sequence
Sequence:
MKSFLSLFAFFLSLLLFANTIAARTDPGEYWRAMMKDEPMPEAIEGLLRIDAAASSFSDEKPN
CHDADQSFEPQKEKTFVKDFEPGHGATAYDNDIKPAEEKSFVKDFNPRSTGEKSSFANDFEPRP
SATAHTDDVGLKEKKLSSFAKSFEPKPSATAYTDDVGSKEKLSIANDFEPRPSVTTYTDNVDLK
EEKLAFVNDFEPRPSATAYTDDVGLREKKLSFANDFEPRPGVTAYTDDVGLKENKLAFAKDFEP
RPSVTAYVDDVGLKEKKLFANDFEPRPSVSAYTDDVGLKKKKLAFANDFEPRPSVSAYTDDVGL
KKKELSFANDFKPRPSVSAYTDNVDLKKKKQFVSDF
The following known motifs were found in CDS evm.model.chr2.934
Location between 4482372 and 4483143
FEPR was found 2 times in this sequence
Sequence:
MKSFLSFFAFLSLLLFANTIAAARKDAGEYWRAVMREQAMPEAIEALVRIDAATSSKEKTDCH
TPTSFELKEEKILVEAFEPRPNEGEKKSFADYFEPRPNVSAYGDDADLKAEKSSSFTKDRPSIP
AYGDDAGLKGEKKSFVSDFEPGPNITVYHD

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 16 - Saccharide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 16. Type = saccharide. Location: 6981109 - 7123472 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 17 - Saccharide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 17. Type = saccharide. Location: 7296443 - 7357721 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 18 - Putative

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 18. Type = putative. Location: 8678971 - 8721165 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 19 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 19. Type = cyclopeptide. Location: 32995180 - 33616058 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
Repeat found in ___NO_NAME_ASSIGNED___
Repeat occurs 5 times in a sequence of 129 amino acids
Location between 33503100 and 33503490
Coverage of 23.26 %
Instances:
GSPFPG | GSPFPG | GSPCSG | GSPFPG | GSPWPG

pattern: GSP[CWF][PS]G
MSPCPGILNPVGSPFPGILNPAGSPFPGILIPLGSPCSGILNPLGSPFPGILNPLLGSPWPGG
LAAGFLPSNPNSMSLSLGRMVWFWFRLEGFVWLMRRLQSLPRKQAIADITTITASTIKTVPNDP
FE

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 20 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 20. Type = cyclopeptide. Location: 497252 - 752949 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 21 - Alkaloid

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 21. Type = alkaloid. Location: 32065712 - 32149212 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 22 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 22. Type = cf_putative. Location: 32562617 - 32668195 nt. ClusterFinder probability: 0.9899. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 23 - Saccharide

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 23. Type = saccharide. Location: 34882689 - 34905643 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 24 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 24. Type = cyclopeptide. Location: 21786632 - 22356747 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
Repeat found in evm.model.chr4.1705
Repeat occurs 8 times in a sequence of 489 amino acids
Location between 22070889 and 22072489
Coverage of 9.82 %
Instances:
KYKPSY | KYKPDY | KYKPGY | KYKPGY | KYKAGY
KYKPGY | KYKPGY | KYKPGY |
pattern: KYK[AP][SDG]Y
MVLRFIYSVLLLCLLLLTCDHGDAVKDLKEKHCDEEEGKTSSSSSYIARLESKYKPSYVVYET
DEKIARLESKYKPDYGVDETEGKSSSPSSYIAHLESKYKPGYVVDEADEKIARLESKYKPGYGV
DEIEKKSSSPSSYIARLESKYKAGYVVDEAEEKIARLESKYKPGYVVDEAKEKSSFPSSYITRL
ENKYKPGYVADETAEESSSLRSYITDLGSKYKPGYIDDQAEEKSLSQPSSKMMEHHSMENHGDD
DIGSEEVGVFTIDDVRAFHVGRKLSTFFSIRNPSLYPGFLPREMADSIPFSSSETSKILQFFSV
SPESPKGKAIKDTLRRCEIEPAKGETKICATSSESMLEFLKNAFGEADFKLISTSHPTMTTPIL
QSYTISEPPREIESPKKVACHPLQYLYAIYMCHYDATETKIFKVPLVGDNGDKVDALIVCHMDT
SAWSPKHTAFSLLGTKPGIPVCHAFSEGHGVWIESSIPVATI

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 25 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 25. Type = cf_putative. Location: 28412221 - 28451410 nt. ClusterFinder probability: 0.9972. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 26 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 26. Type = cf_putative. Location: 29299426 - 29427312 nt. ClusterFinder probability: 0.8487. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 27 - Alkaloid

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 27. Type = alkaloid. Location: 30347460 - 30478760 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 28 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 28. Type = cf_putative. Location: 30997862 - 31157037 nt. ClusterFinder probability: 0.9726. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 29 - Putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 29. Type = putative. Location: 31580342 - 31658167 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 30 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 30. Type = cf_putative. Location: 32077708 - 32192655 nt. ClusterFinder probability: 0.9892. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 31 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 31. Type = cf_putative. Location: 33396433 - 33427234 nt. ClusterFinder probability: 0.8689. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 32 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 32. Type = cf_putative. Location: 34151297 - 34163963 nt. ClusterFinder probability: 0.9452. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5 - Cluster 33 - Saccharide

Gene cluster description

Download cluster GenBank file
chr5 - Gene Cluster 33. Type = saccharide. Location: 3919178 - 4075295 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5 - Cluster 34 - Saccharide

Gene cluster description

Download cluster GenBank file
chr5 - Gene Cluster 34. Type = saccharide. Location: 33504152 - 33571071 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6 - Cluster 35 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr6 - Gene Cluster 35. Type = cf_putative. Location: 608438 - 649289 nt. ClusterFinder probability: 0.8766. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6 - Cluster 36 - Terpene

Gene cluster description

Download cluster GenBank file
chr6 - Gene Cluster 36. Type = terpene. Location: 6565585 - 6735973 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6 - Cluster 37 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr6 - Gene Cluster 37. Type = cf_putative. Location: 23303357 - 23355184 nt. ClusterFinder probability: 0.9517. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6 - Cluster 38 - Terpene

Gene cluster description

Download cluster GenBank file
chr6 - Gene Cluster 38. Type = terpene. Location: 26028321 - 26108017 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7 - Cluster 39 - Terpene

Gene cluster description

Download cluster GenBank file
chr7 - Gene Cluster 39. Type = terpene. Location: 3077590 - 3235028 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7 - Cluster 40 - Terpene

Gene cluster description

Download cluster GenBank file
chr7 - Gene Cluster 40. Type = terpene. Location: 13805210 - 17246981 nt. ClusterFinder probability: 0.9237. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8 - Cluster 41 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr8 - Gene Cluster 41. Type = cf_putative. Location: 400695 - 490872 nt. ClusterFinder probability: 0.8370. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8 - Cluster 42 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr8 - Gene Cluster 42. Type = cf_putative. Location: 1326541 - 1496282 nt. ClusterFinder probability: 0.9505. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8 - Cluster 43 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr8 - Gene Cluster 43. Type = cf_putative. Location: 2509374 - 2590896 nt. ClusterFinder probability: 0.9323. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8 - Cluster 44 - Saccharide

Gene cluster description

Download cluster GenBank file
chr8 - Gene Cluster 44. Type = saccharide. Location: 4062653 - 4120411 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 45 - Saccharide

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 45. Type = saccharide. Location: 421724 - 456208 nt. ClusterFinder probability: 0.9477. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 46 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 46. Type = cyclopeptide. Location: 1792236 - 2081806 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 47 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 47. Type = cf_putative. Location: 5590367 - 5742696 nt. ClusterFinder probability: 0.9260. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 48 - Putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 48. Type = putative. Location: 8435203 - 8594643 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 49 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 49. Type = cf_putative. Location: 9671102 - 10473620 nt. ClusterFinder probability: 0.8885. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 50 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 50. Type = cyclopeptide. Location: 33631638 - 34118909 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
Repeat found in evm.model.chr9.2927
Repeat occurs 3 times in a sequence of 258 amino acids
Location between 33869328 and 33873018
Coverage of 8.14 %
Instances:
SQARNPK | SQAKNSK | SQARNPQ |
pattern: SQA[KR]N[PS][QK]
MASHFLLIFALLNLAFAGSHGALPEEVYWKSVFPNSPMPKALKDILPPAGEARALQSMDMESQ
ARNPKTKVVLLCFMDTEIHLKNFKEILHGLRNALQMLITLRLALLISTIMDMDSQAKNSKAKME
SQARNPQIKVVFLCFMDMETHLKNLKAILPDLQAILHTTIMEMEPLARNSKGKCIPEVNRTPSW
ILISTGNSLTILQSTKLSISSKRIYAQERWTYHYSRQRTLHFCLSKLLNQFPFRVTSVKFSTFI
NAE

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 51 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 51. Type = cyclopeptide. Location: 33693388 - 34205175 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
Repeat found in evm.model.chr9.2927
Repeat occurs 3 times in a sequence of 258 amino acids
Location between 33869328 and 33873018
Coverage of 8.14 %
Instances:
SQARNPK | SQAKNSK | SQARNPQ |
pattern: SQA[KR]N[PS][QK]
MASHFLLIFALLNLAFAGSHGALPEEVYWKSVFPNSPMPKALKDILPPAGEARALQSMDMESQ
ARNPKTKVVLLCFMDTEIHLKNFKEILHGLRNALQMLITLRLALLISTIMDMDSQAKNSKAKME
SQARNPQIKVVFLCFMDMETHLKNLKAILPDLQAILHTTIMEMEPLARNSKGKCIPEVNRTPSW
ILISTGNSLTILQSTKLSISSKRIYAQERWTYHYSRQRTLHFCLSKLLNQFPFRVTSVKFSTFI
NAE

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 52 - Saccharide

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 52. Type = saccharide. Location: 39505003 - 39555386 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 53 - Putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 53. Type = putative. Location: 39661680 - 39745125 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 54 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 54. Type = cf_putative. Location: 40193470 - 40220523 nt. ClusterFinder probability: 0.8079. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 55 - Lignan-polyketide

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 55. Type = lignan-polyketide. Location: 40375094 - 40435319 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 56 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 56. Type = cf_putative. Location: 41796588 - 41973600 nt. ClusterFinder probability: 0.8813. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.