Identified secondary metabolite clusters

Cluster Type From To Size (kb) Core domains Most similar known cluster MIBiG BGC-ID
The following clusters are from record chr8:
Cluster 1Saccharide227614162282036658.95Aminotran_1_2, Glycos_transf_2, SE--
Cluster 2Cf_putative244400472453364093.59--
Cluster 3Cf_putative2611246726387457274.99--
Cluster 4Cf_putative270497652714826498.50--
The following clusters are from record chr2:
Cluster 5Putative81675418725817558.28COesterase, Transferase, p450--
Cluster 6Cyclopeptide10404303118519591447.66BURP--
Cluster 7Putative428254764289905673.58Peptidase_S10, p450--
Cluster 8Saccharide445154784460903693.56DAHP_synth_2, UDPGT_2, UbiA--
Cluster 9Cyclopeptide4733211447485863153.75BURP--
Cluster 10Cf_putative476252704770603680.77--
Cluster 11Cyclopeptide5028135850568784287.43BURP--
Cluster 12Saccharide507710355083973168.70AMP-binding, UDPGT_2, p450--
The following clusters are from record chr5:
Cluster 13Saccharide9458034952281064.78AMP-binding, Cellulose_synt, UDPGT_2--
Cluster 14Saccharide96201539737500117.352OG-FeII_Oxy, DIOX_N, UDPGT_2--
Cluster 15Cf_putative5037001550525297155.28--
The following clusters are from record chr9:
Cluster 16Cf_putative2364419240774043.32--
Cluster 17Saccharide3056888309714240.25UDPGT_2, p450--
Cluster 18Saccharide3206521327631069.79UDPGT_2, p450--
Cluster 19Terpene5469403550621336.81Terpene_synth, Terpene_synth_C--
Cluster 20Cyclopeptide957815310464347886.19BURP--
Cluster 21Cf_putative1274416913080651336.48--
Cluster 22Cf_putative35915976369348291018.85--
Cluster 23Putative3789270538018244125.542OG-FeII_Oxy, Aminotran_1_2, DIOX_N--
Cluster 24Cf_putative4108726641247294160.03--
Cluster 25Saccharide467798254681528335.46Epimerase, Glycos_transf_2, p450--
The following clusters are from record chr1:
Cluster 26Putative490398611054120.66Acetyltransf_1, Amino_oxidase, Epimerase, Methyltransf_11--
Cluster 27Cf_putative3375940733994067234.66--
Cluster 28Cf_putative3514669735399439252.74--
Cluster 29Cf_putative429706884300530334.62--
Cluster 30Saccharide451024654517371871.25UDPGT_2, polyprenyl_synt--
Cluster 31Putative4562884145843024214.18Methyltransf_7, p450--
Cluster 32Cf_putative459504444600991359.47--
The following clusters are from record chr3:
Cluster 33Saccharide60792463631128.39Epimerase, UDPGT_2--
Cluster 34Saccharide1739609177825638.65Epimerase, UDPGT_2--
Cluster 35Cf_putative30891183233728144.61--
Cluster 36Alkaloid36523953776767124.37Cu_amine_oxid, Epimerase, p450--
Cluster 37Cf_putative1508420916034024949.82--
Cluster 38Cyclopeptide4349997043747150247.18BURP--
The following clusters are from record chr4:
Cluster 39Cf_putative40910742084711.74--
Cluster 40Cf_putative1244153128279038.64--
Cluster 41Cf_putative25869752722213135.24--
Cluster 42Cf_putative39074204071182163.76--
Cluster 43Alkaloid46678784773879106.00Cu_amine_oxid, Lipoxygenase--
Cluster 44Cf_putative7013843705204938.21--
Cluster 45Saccharide71852477343678158.43AMP-binding, UDPGT_2--
Cluster 46Cyclopeptide1419626814722505526.24BURP--
Cluster 47Cyclopeptide28639073316274472988.37BURP--
The following clusters are from record chr7:
Cluster 48Terpene1017042310324162153.74Terpene_synth, Terpene_synth_C, p450--
Cluster 49Terpene1044688910909672462.78Terpene_synth, Terpene_synth_C, p450--
Cluster 50Terpene1317822713347844169.62Terpene_synth, Terpene_synth_C, p450--
Cluster 51Terpene138146121387470660.09Terpene_synth, Terpene_synth_C, p450--
Cluster 52Cf_putative2765689528186756529.86--
Cluster 53Cf_putative28893669298968411003.17--
Cluster 54Terpene3331639133548354231.96Terpene_synth, Terpene_synth_C--
The following clusters are from record chr6:
Cluster 55Terpene1875709196751491.81Epimerase, Terpene_synth, Terpene_synth_C--
Cluster 56Cf_putative4914974498096765.99--
Cluster 57Terpene2422668024554065327.38Prenyltrans, SQHop_cyclase_C, SQHop_cyclase_N, p450--
Cluster 58Cf_putative329188723294941230.54--
The following clusters are from record chr10:
Cluster 59Cf_putative248551722493493179.76--
Cluster 60Cf_putative2994302530071100128.07--

chr8 - Cluster 1 - Saccharide

Gene cluster description

Download cluster GenBank file
chr8 - Gene Cluster 1. Type = saccharide. Location: 22761416 - 22820366 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8 - Cluster 2 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr8 - Gene Cluster 2. Type = cf_putative. Location: 24440047 - 24533640 nt. ClusterFinder probability: 0.9631. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8 - Cluster 3 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr8 - Gene Cluster 3. Type = cf_putative. Location: 26112467 - 26387457 nt. ClusterFinder probability: 0.8278. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8 - Cluster 4 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr8 - Gene Cluster 4. Type = cf_putative. Location: 27049765 - 27148264 nt. ClusterFinder probability: 0.8265. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 5 - Putative

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 5. Type = putative. Location: 8167541 - 8725817 nt. ClusterFinder probability: 0.9919. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 6 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 6. Type = cyclopeptide. Location: 10404303 - 11851959 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
Repeat found in evm.model.chr2.3443
Repeat occurs 4 times in a sequence of 78 amino acids
Location between 11573764 and 11574001
Coverage of 46.15 %
Instances:
SAHVDICHV | SAHDDICHV | SAHDDVCHM | SAHDDISYV |
pattern: SAH[DV]D[IV][CS][YH][MV]
MIFVMCGMGVYMTVMVAYSMGAQDNDICHVRCGSAHVDICHVQCGSAHDDICHVLCGSAHDDV
CHMRCESAHDDISYV
Repeat found in ___NO_NAME_ASSIGNED___
Repeat occurs 4 times in a sequence of 129 amino acids
Location between 10822863 and 10823253
Coverage of 18.6 %
Instances:
GSPFPG | GSPFPG | GSPCSG | GSPFPG |
pattern: GSP[CF][PS]G
MSPCPGTLNPVGSPFPGILNPAGSPFPGILIPLGSPCSGILNPLGSPFPGTLNPLLGSLWPGG
LAAGFLPSNPNSMSLSLGRIVWFWFCLEGFVWLMRRLQSLPRKQAIADITMITASTIKTVPNDP
LE

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 7 - Putative

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 7. Type = putative. Location: 42825476 - 42899056 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 8 - Saccharide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 8. Type = saccharide. Location: 44515478 - 44609036 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 9 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 9. Type = cyclopeptide. Location: 47332114 - 47485863 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
The following known motifs were found in CDS evm.model.chr2.1007
Location between 47420279 and 47421034
FEPR was found 2 times in this sequence
Sequence:
MKSFLSLFAFLSLLLFADTIAAARKDAGEYWRAVMRDQAMPEAIEALVRIDAATSSKEKTDCH
TPTSFELKEEKIIVEDFEPRPTKGEKKSFADDFEPRPNVSAYGDDADLKAEKSPSFAKGRPNIS
ATGDDADLKGENKSFVSDFEPGPNVSVYHD
The following known motifs were found in CDS evm.model.chr2.1008
Location between 47416152 and 47417315
FEPR was found 6 times in this sequence
Sequence:
MKSFLSLFAFFLSLLLFGNTIAARTDPGEYWRAIMKDEPMPEAIEGLLRIDAAASSSSDEKPN
CHDADPSFEPKKEKTFVKDFEPGHGVTAYDNDIKPAEEKSFFKDFNPRSNGEKSSFANDFEPRP
GATAYTDDVGLKEKKLSSFAKSFEPKPSATAYTDDIGSKEKLSIANDFEPRPSLSAYTDDVSLE
DKKLSFANDFEPRPGITATADDIGLKEKKSFANDFEPRPSATAYTDDVGFKEKKLAFANDFEPR
PGITANADDIGLKEKKSFANDFEPRPSATAYTDNVDLKKKKQFVSDF

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 10 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 10. Type = cf_putative. Location: 47625270 - 47706036 nt. ClusterFinder probability: 0.9413. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 11 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 11. Type = cyclopeptide. Location: 50281358 - 50568784 nt. ClusterFinder probability: 0.9569. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 12 - Saccharide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 12. Type = saccharide. Location: 50771035 - 50839731 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5 - Cluster 13 - Saccharide

Gene cluster description

Download cluster GenBank file
chr5 - Gene Cluster 13. Type = saccharide. Location: 9458034 - 9522810 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5 - Cluster 14 - Saccharide

Gene cluster description

Download cluster GenBank file
chr5 - Gene Cluster 14. Type = saccharide. Location: 9620153 - 9737500 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5 - Cluster 15 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr5 - Gene Cluster 15. Type = cf_putative. Location: 50370015 - 50525297 nt. ClusterFinder probability: 0.8121. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 16 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 16. Type = cf_putative. Location: 2364419 - 2407740 nt. ClusterFinder probability: 0.7955. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 17 - Saccharide

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 17. Type = saccharide. Location: 3056888 - 3097142 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 18 - Saccharide

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 18. Type = saccharide. Location: 3206521 - 3276310 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 19 - Terpene

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 19. Type = terpene. Location: 5469403 - 5506213 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 20 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 20. Type = cyclopeptide. Location: 9578153 - 10464347 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 21 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 21. Type = cf_putative. Location: 12744169 - 13080651 nt. ClusterFinder probability: 0.9236. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 22 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 22. Type = cf_putative. Location: 35915976 - 36934829 nt. ClusterFinder probability: 0.8758. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 23 - Putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 23. Type = putative. Location: 37892705 - 38018244 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 24 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 24. Type = cf_putative. Location: 41087266 - 41247294 nt. ClusterFinder probability: 0.9166. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 25 - Saccharide

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 25. Type = saccharide. Location: 46779825 - 46815283 nt. ClusterFinder probability: 0.9501. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 26 - Putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 26. Type = putative. Location: 490398 - 611054 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 27 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 27. Type = cf_putative. Location: 33759407 - 33994067 nt. ClusterFinder probability: 0.8520. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 28 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 28. Type = cf_putative. Location: 35146697 - 35399439 nt. ClusterFinder probability: 0.8079. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 29 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 29. Type = cf_putative. Location: 42970688 - 43005303 nt. ClusterFinder probability: 0.8957. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 30 - Saccharide

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 30. Type = saccharide. Location: 45102465 - 45173718 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 31 - Putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 31. Type = putative. Location: 45628841 - 45843024 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 32 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 32. Type = cf_putative. Location: 45950444 - 46009913 nt. ClusterFinder probability: 0.9859. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 33 - Saccharide

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 33. Type = saccharide. Location: 607924 - 636311 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 34 - Saccharide

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 34. Type = saccharide. Location: 1739609 - 1778256 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 35 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 35. Type = cf_putative. Location: 3089118 - 3233728 nt. ClusterFinder probability: 0.9422. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 36 - Alkaloid

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 36. Type = alkaloid. Location: 3652395 - 3776767 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 37 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 37. Type = cf_putative. Location: 15084209 - 16034024 nt. ClusterFinder probability: 0.8151. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 38 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 38. Type = cyclopeptide. Location: 43499970 - 43747150 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 39 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 39. Type = cf_putative. Location: 409107 - 420847 nt. ClusterFinder probability: 0.9682. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 40 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 40. Type = cf_putative. Location: 1244153 - 1282790 nt. ClusterFinder probability: 0.8660. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 41 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 41. Type = cf_putative. Location: 2586975 - 2722213 nt. ClusterFinder probability: 0.9614. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 42 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 42. Type = cf_putative. Location: 3907420 - 4071182 nt. ClusterFinder probability: 0.9782. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 43 - Alkaloid

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 43. Type = alkaloid. Location: 4667878 - 4773879 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 44 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 44. Type = cf_putative. Location: 7013843 - 7052049 nt. ClusterFinder probability: 0.9356. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 45 - Saccharide

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 45. Type = saccharide. Location: 7185247 - 7343678 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 46 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 46. Type = cyclopeptide. Location: 14196268 - 14722505 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
Repeat found in evm.model.chr4.2206
Repeat occurs 6 times in a sequence of 444 amino acids
Location between 14458643 and 14460129
Coverage of 9.46 %
Instances:
LESKCKP | LESKYKP | LESKYKP | LESKYKP | LESKYKP
LESKYKS |
pattern: LESK[YC]K[PS]
MVLRFIYSVLLLCLLLLTCDRGDAVKDLKRKHSNANFHKNCDEEEGETSSWSSYITHLESKCK
PGYVVYETDEKIARLESKYKPSYEVDETEGKSSSPSSYISHLESKYKPSYVVDEADEKIARLES
KYKPDYGVDEAEGKSSSPSAYIAHLESKYKPAYDVDEADEKIARLESKYKSGYVVDDEAEEKSL
SQPSSKMMEHHSMENHGDDDIGSEEVGVFTIDDVRAFHVGRKLSTFFSIRNPSLYPGFIPREMA
DSIPFSSSETSKILQFFSVSPESPKGKAIKDTLRRCEIKPAKGETKICATSSESMLEFLKNAFG
EADFKLISTSHPTMTTPTLQSYTILEPPREIESPKKVACHPLQYLYAIYMCHYDARETKIFKVR
LVGDNGDKVDALIVCHMDTSAWSPKHTAFSLLGTKPGIPVCHAFSEGHGVWIESSIPVATI
Repeat found in evm.model.chr4.2209
Repeat occurs 4 times in a sequence of 120 amino acids
Location between 14501121 and 14501589
Coverage of 23.33 %
Instances:
KRRECAA | KRRRFGP | KRRRFGP | KRRRFGP |
pattern: KRR[RE][CF][AG][AP]
MKGAVTTPEPVQVTGSRRALGPPSNRAASGLKRRECAAGRERIRETKSGDGEDERGRYRGPKR
RRFGPLYREDIKAKRRRFGPLYRADKEGQKRRRFGPLYRADTEGQNDVVLALYIGQI

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 47 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 47. Type = cyclopeptide. Location: 28639073 - 31627447 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
Repeat found in evm.model.chr4.3241
Repeat occurs 6 times in a sequence of 218 amino acids
Location between 31432147 and 31432804
Coverage of 16.51 %
Instances:
SIRMHL | SIRMHL | SIRMHL | SIRIHL | SIRMHL
SIRIHL |
pattern: SIR[IM]HL
MSPPASASTRCVTTSIRMHLACHHKFLHALGVSITVSASIWRVTISIRMHLACHHQFLHALGV
SPVVSVSTWSVITSIRMHLMCHHQFSCTWHATNSIHIHLACHHQYPHALGMSPPVSTCTSLITT
SIRIHLACNDQNLHPLGVSPPFSVCTWRVTTSILSIWSVTISIRMHLACHHQCLHGLNVSPPVS
SSTWRVTISIRIHLMSKKVYMHLASHH
Repeat found in evm.model.chr4.3238
Repeat occurs 4 times in a sequence of 100 amino acids
Location between 31368761 and 31369064
Coverage of 44.0 %
Instances:
VAHELVSAHGA | VAHELVSAHGA | VAHELVSAHGA | VAHELVSAQGA |
pattern: VAHELVSA[QH]GA
MWGDAHCSSSYVHDVGVAHELVSAHGAHDDDSSYVRDVGVAHELVSAHGAQDDSSYVSNVGVA
HELVSAHGAQDNSSYVHDAGVAHELVSAQGAHDIFNW

Similar gene clusters

No significant ClusterBlast hits found.

chr7 - Cluster 48 - Terpene

Gene cluster description

Download cluster GenBank file
chr7 - Gene Cluster 48. Type = terpene. Location: 10170423 - 10324162 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7 - Cluster 49 - Terpene

Gene cluster description

Download cluster GenBank file
chr7 - Gene Cluster 49. Type = terpene. Location: 10446889 - 10909672 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7 - Cluster 50 - Terpene

Gene cluster description

Download cluster GenBank file
chr7 - Gene Cluster 50. Type = terpene. Location: 13178227 - 13347844 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7 - Cluster 51 - Terpene

Gene cluster description

Download cluster GenBank file
chr7 - Gene Cluster 51. Type = terpene. Location: 13814612 - 13874706 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7 - Cluster 52 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr7 - Gene Cluster 52. Type = cf_putative. Location: 27656895 - 28186756 nt. ClusterFinder probability: 0.8690. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7 - Cluster 53 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr7 - Gene Cluster 53. Type = cf_putative. Location: 28893669 - 29896841 nt. ClusterFinder probability: 0.9383. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7 - Cluster 54 - Terpene

Gene cluster description

Download cluster GenBank file
chr7 - Gene Cluster 54. Type = terpene. Location: 33316391 - 33548354 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6 - Cluster 55 - Terpene

Gene cluster description

Download cluster GenBank file
chr6 - Gene Cluster 55. Type = terpene. Location: 1875709 - 1967514 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6 - Cluster 56 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr6 - Gene Cluster 56. Type = cf_putative. Location: 4914974 - 4980967 nt. ClusterFinder probability: 0.9491. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6 - Cluster 57 - Terpene

Gene cluster description

Download cluster GenBank file
chr6 - Gene Cluster 57. Type = terpene. Location: 24226680 - 24554065 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6 - Cluster 58 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr6 - Gene Cluster 58. Type = cf_putative. Location: 32918872 - 32949412 nt. ClusterFinder probability: 0.9348. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr10 - Cluster 59 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr10 - Gene Cluster 59. Type = cf_putative. Location: 24855172 - 24934931 nt. ClusterFinder probability: 0.8942. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr10 - Cluster 60 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr10 - Gene Cluster 60. Type = cf_putative. Location: 29943025 - 30071100 nt. ClusterFinder probability: 0.8575. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.