Identified secondary metabolite clusters

Cluster Type From To Size (kb) Core domains Most similar known cluster MIBiG BGC-ID
The following clusters are from record chr10:
Cluster 1Cf_putative31375843261228123.64--
Cluster 2Cf_putative80149918210494195.50--
The following clusters are from record chr1:
Cluster 3Cf_putative1356755141623859.48--
Cluster 4Saccharide2137992220835070.36UDPGT_2, polyprenyl_synt--
Cluster 5Cf_putative4261964429658634.62--
Cluster 6Saccharide57200555834206114.15DAHP_synth_2, UDPGT_2--
Cluster 7Cf_putative1099220511266831274.63--
Cluster 8Cf_putative1234927312580458231.19--
Cluster 9Putative4589346946040170146.70Amino_oxidase, Epimerase, Methyltransf_11--
The following clusters are from record chr2:
Cluster 10Putative84881649039709551.54COesterase, Transferase, p450--
Cluster 11Cyclopeptide10586312123664661780.15BURP--
Cluster 12Putative418137924188677272.98Peptidase_S10, p450--
Cluster 13Saccharide435291994359117661.98DAHP_synth_2, UDPGT_2--
Cluster 14Cyclopeptide4628561846496921211.30BURP--
Cluster 15Cf_putative466123994667701364.61--
Cluster 16Cyclopeptide4923027849517072286.79BURP--
Cluster 17Saccharide4971777649836837119.06AMP-binding, UDPGT_2, p450--
The following clusters are from record chr3:
Cluster 18Cyclopeptide449945732818282.87BURP--
Cluster 19Alkaloid4024133540372971131.64Cu_amine_oxid, Epimerase, p450--
Cluster 20Cf_putative4078569740896335110.64--
Cluster 21Saccharide422102254224940539.18Epimerase, UDPGT_2--
Cluster 22Saccharide433476224337650728.89Epimerase, UDPGT_2--
The following clusters are from record chr4:
Cluster 23Cyclopeptide10913340137703682857.03BURP--
Cluster 24Cf_putative23311647247509201439.27--
Cluster 25Cyclopeptide2680238127348916546.53BURP--
Cluster 26Putative2757005527833146263.09Methyltransf_7, adh_short_C2, p450--
Cluster 27Cf_putative344779633451722839.27--
Cluster 28Cf_putative3543315535619180186.03--
Cluster 29Cf_putative3740596137591551185.59--
Cluster 30Putative3812193938268056146.122OG-FeII_Oxy, DIOX_N--
Cluster 31Cf_putative3873978938885650145.86--
Cluster 32Cf_putative401939944022828034.29--
Cluster 33Cf_putative410752884108702411.74--
The following clusters are from record chr5:
Cluster 34Saccharide9115255918017264.92AMP-binding, Cellulose_synt, UDPGT_2--
Cluster 35Cf_putative4831335648458927145.57--
The following clusters are from record chr6:
Cluster 36Terpene18892132018535129.32Epimerase, Terpene_synth, Terpene_synth_C--
Cluster 37Putative4553186463691883.732OG-FeII_Oxy, DIOX_N--
Cluster 38Cf_putative4926538499404667.51--
Cluster 39Terpene2500492925320077315.15Prenyltrans, SQHop_cyclase_C, SQHop_cyclase_N, p450--
Cluster 40Cf_putative338972753392784430.57--
The following clusters are from record chr7:
Cluster 41Terpene459145461989861607.53Epimerase, Terpene_synth, Terpene_synth_C--
Cluster 42Terpene2877395529613382839.43Terpene_synth, Terpene_synth_C, p450--
Cluster 43Terpene2974407429925624181.55Terpene_synth, Terpene_synth_C, p450--
The following clusters are from record chr8:
Cluster 44Cf_putative44668054123794.56--
Cluster 45Cf_putative3072894316800895.11--
Cluster 46Saccharide4769416482836058.94Aminotran_1_2, Glycos_transf_2, SE--
The following clusters are from record chr9:
Cluster 47Saccharide43820647365335.45Epimerase, Glycos_transf_2, p450--
Cluster 48Cf_putative60606576216872156.22--
Cluster 49Cf_putative1034887210776335427.46--
Cluster 50Cf_putative3383973034479310639.58--
Cluster 51Cyclopeptide3643452937349905915.38BURP--
Cluster 52Saccharide436646054370358638.98UDPGT_2, p450--
Cluster 53Cf_putative443601644438653426.37--

chr10 - Cluster 1 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr10 - Gene Cluster 1. Type = cf_putative. Location: 3137584 - 3261228 nt. ClusterFinder probability: 0.8867. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr10 - Cluster 2 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr10 - Gene Cluster 2. Type = cf_putative. Location: 8014991 - 8210494 nt. ClusterFinder probability: 0.8892. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 3 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 3. Type = cf_putative. Location: 1356755 - 1416238 nt. ClusterFinder probability: 0.9679. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 4 - Saccharide

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 4. Type = saccharide. Location: 2137992 - 2208350 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 5 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 5. Type = cf_putative. Location: 4261964 - 4296586 nt. ClusterFinder probability: 0.9043. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 6 - Saccharide

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 6. Type = saccharide. Location: 5720055 - 5834206 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 7 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 7. Type = cf_putative. Location: 10992205 - 11266831 nt. ClusterFinder probability: 0.9710. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 8 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 8. Type = cf_putative. Location: 12349273 - 12580458 nt. ClusterFinder probability: 0.8381. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr1 - Cluster 9 - Putative

Gene cluster description

Download cluster GenBank file
chr1 - Gene Cluster 9. Type = putative. Location: 45893469 - 46040170 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 10 - Putative

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 10. Type = putative. Location: 8488164 - 9039709 nt. ClusterFinder probability: 0.9885. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 11 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 11. Type = cyclopeptide. Location: 10586312 - 12366466 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
Repeat found in evm.model.chr2.1318
Repeat occurs 7 times in a sequence of 146 amino acids
Location between 10666450 and 10666992
Coverage of 28.77 %
Instances:
HAGDTT | HAGDTT | HAGDTT | HAGDTP | HAGDTT
HAGHTP | HAGDTT |
pattern: HAG[HD]T[PT]
MHAGDTTPIAGRHAGDTTSAHRHAGDTTSACRHAGDTPSAHRHAGDTTSAFRHAGHTPNACRH
AGDTTSACRYAGQTQKHTLMSSPQWGLFFEDNMAKREINHGTKTMVLNRELTELTRFRELRELM
TMVLNTELIQFRELREKDE

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 12 - Putative

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 12. Type = putative. Location: 41813792 - 41886772 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 13 - Saccharide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 13. Type = saccharide. Location: 43529199 - 43591176 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 14 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 14. Type = cyclopeptide. Location: 46285618 - 46496921 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
The following known motifs were found in CDS evm.model.chr2.3620
Location between 46410562 and 46411725
FEPR was found 6 times in this sequence
Sequence:
MKSFLSLFAFFLSLLLFGNTIAARTDPGEYWRAIMKDEPMPEAIEGLLRIDAAASSSSDEKPN
CHDADPSFEPKKEKTFVKDFEPGHGATAYDNDIKPAEEKSFFKDFNPRSNGEKSSFANDFEPRP
GVTAYTDDVGLKEKKLSSFAKSFEPKPSATAYTDDIGSKEKLSIANDFEPRPSLSAYTDDVSLE
DKKLSFANDFEPRPGITANADDIGLKEKKSFANDFEPRPSATAYTDDVGFKEKKLAFANDFEPR
PGITANADDIGLKEKKSFANDFEPRPSATAYTDNVDLKKKKQFVSDF
The following known motifs were found in CDS evm.model.chr2.3621
Location between 46414692 and 46415447
FEPR was found 2 times in this sequence
Sequence:
MKSFLSFFAFLSLLLFADTIAAARKDAGEYWRAVMRDQAMPEAIEALVRIDAATSSKEKTDCH
TPTSFELKEEKIIVEDFEPRPTKGEKKSFADDFEPRPNVSAYGDDADLKAEKSPSFAKGRPNIS
ATGDDADLKGENKSFVSDFEPGPNVSVYHD

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 15 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 15. Type = cf_putative. Location: 46612399 - 46677013 nt. ClusterFinder probability: 0.9613. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 16 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 16. Type = cyclopeptide. Location: 49230278 - 49517072 nt. ClusterFinder probability: 0.9701. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr2 - Cluster 17 - Saccharide

Gene cluster description

Download cluster GenBank file
chr2 - Gene Cluster 17. Type = saccharide. Location: 49717776 - 49836837 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 18 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 18. Type = cyclopeptide. Location: 449945 - 732818 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 19 - Alkaloid

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 19. Type = alkaloid. Location: 40241335 - 40372971 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 20 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 20. Type = cf_putative. Location: 40785697 - 40896335 nt. ClusterFinder probability: 0.9905. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 21 - Saccharide

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 21. Type = saccharide. Location: 42210225 - 42249405 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr3 - Cluster 22 - Saccharide

Gene cluster description

Download cluster GenBank file
chr3 - Gene Cluster 22. Type = saccharide. Location: 43347622 - 43376507 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 23 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 23. Type = cyclopeptide. Location: 10913340 - 13770368 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 24 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 24. Type = cf_putative. Location: 23311647 - 24750920 nt. ClusterFinder probability: 0.9419. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 25 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 25. Type = cyclopeptide. Location: 26802381 - 27348916 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes
Repeat found in evm.model.chr4.1734
Repeat occurs 6 times in a sequence of 444 amino acids
Location between 27074908 and 27076388
Coverage of 9.46 %
Instances:
LESKCKP | LESKYKP | LESKYKP | LESKYKP | LESKYKP
LESKYKS |
pattern: LESK[YC]K[PS]
MVLRFIYSVLLLCLLLLTCDRGDAVKDLKRKHSNANFHKNCDEEEGETSSWSSYITHLESKCK
PGYVVYETDEKIARLESKYKPSYEVDETEGKSSSPSSYISHLESKYKPSYVVDEADEKIARLES
KYKPDYGVDEAEGKSSSPSAYIAHLESKYKPAYDVDEADEKIARLESKYKSGYVVDDEAEEKSL
SQPSSKMMEHHSMENHGDDDIGSEEVGVFTIDDVRAFHVGRKLSTFFSIRNPSLYPGFIPREMA
DSIPFSSSETSKILQFFSVSPESPKGKAIKDTLRRCEIKPAKGETKICATSSESMLEFLKNAFG
EADFKLISTSHPTMTTPTLQSYTILEPPREIESPKKVACHPLQYLYAIYMCHYDARETKIFKVR
LVGDNGDKVDALIVCHMDTSAWSPKHTAFSLLGTKPGIPVCHAFSEGHGVWIESSIPVATI

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 26 - Putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 26. Type = putative. Location: 27570055 - 27833146 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 27 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 27. Type = cf_putative. Location: 34477963 - 34517228 nt. ClusterFinder probability: 0.9972. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 28 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 28. Type = cf_putative. Location: 35433155 - 35619180 nt. ClusterFinder probability: 0.8492. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 29 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 29. Type = cf_putative. Location: 37405961 - 37591551 nt. ClusterFinder probability: 0.9710. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 30 - Putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 30. Type = putative. Location: 38121939 - 38268056 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 31 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 31. Type = cf_putative. Location: 38739789 - 38885650 nt. ClusterFinder probability: 0.9847. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 32 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 32. Type = cf_putative. Location: 40193994 - 40228280 nt. ClusterFinder probability: 0.9001. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr4 - Cluster 33 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr4 - Gene Cluster 33. Type = cf_putative. Location: 41075288 - 41087024 nt. ClusterFinder probability: 0.9608. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5 - Cluster 34 - Saccharide

Gene cluster description

Download cluster GenBank file
chr5 - Gene Cluster 34. Type = saccharide. Location: 9115255 - 9180172 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr5 - Cluster 35 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr5 - Gene Cluster 35. Type = cf_putative. Location: 48313356 - 48458927 nt. ClusterFinder probability: 0.8239. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6 - Cluster 36 - Terpene

Gene cluster description

Download cluster GenBank file
chr6 - Gene Cluster 36. Type = terpene. Location: 1889213 - 2018535 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6 - Cluster 37 - Putative

Gene cluster description

Download cluster GenBank file
chr6 - Gene Cluster 37. Type = putative. Location: 4553186 - 4636918 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6 - Cluster 38 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr6 - Gene Cluster 38. Type = cf_putative. Location: 4926538 - 4994046 nt. ClusterFinder probability: 0.9532. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6 - Cluster 39 - Terpene

Gene cluster description

Download cluster GenBank file
chr6 - Gene Cluster 39. Type = terpene. Location: 25004929 - 25320077 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr6 - Cluster 40 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr6 - Gene Cluster 40. Type = cf_putative. Location: 33897275 - 33927844 nt. ClusterFinder probability: 0.9348. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7 - Cluster 41 - Terpene

Gene cluster description

Download cluster GenBank file
chr7 - Gene Cluster 41. Type = terpene. Location: 4591454 - 6198986 nt. ClusterFinder probability: 0.9755. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7 - Cluster 42 - Terpene

Gene cluster description

Download cluster GenBank file
chr7 - Gene Cluster 42. Type = terpene. Location: 28773955 - 29613382 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr7 - Cluster 43 - Terpene

Gene cluster description

Download cluster GenBank file
chr7 - Gene Cluster 43. Type = terpene. Location: 29744074 - 29925624 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8 - Cluster 44 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr8 - Gene Cluster 44. Type = cf_putative. Location: 446680 - 541237 nt. ClusterFinder probability: 0.8165. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8 - Cluster 45 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr8 - Gene Cluster 45. Type = cf_putative. Location: 3072894 - 3168008 nt. ClusterFinder probability: 0.9382. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr8 - Cluster 46 - Saccharide

Gene cluster description

Download cluster GenBank file
chr8 - Gene Cluster 46. Type = saccharide. Location: 4769416 - 4828360 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 47 - Saccharide

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 47. Type = saccharide. Location: 438206 - 473653 nt. ClusterFinder probability: 0.9501. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 48 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 48. Type = cf_putative. Location: 6060657 - 6216872 nt. ClusterFinder probability: 0.9130. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 49 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 49. Type = cf_putative. Location: 10348872 - 10776335 nt. ClusterFinder probability: 0.8841. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 50 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 50. Type = cf_putative. Location: 33839730 - 34479310 nt. ClusterFinder probability: 0.9176. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 51 - Cyclopeptide

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 51. Type = cyclopeptide. Location: 36434529 - 37349905 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 52 - Saccharide

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 52. Type = saccharide. Location: 43664605 - 43703586 nt. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.

chr9 - Cluster 53 - Cf_putative

Gene cluster description

Download cluster GenBank file
chr9 - Gene Cluster 53. Type = cf_putative. Location: 44360164 - 44386534 nt. ClusterFinder probability: 0.8082. Click on genes for more information.
Show pHMM detection rules used

Legend:

Only available when smCOG analysis was run
biosynthetic genes
transport-related genes
regulatory genes
other genes

Similar gene clusters

No significant ClusterBlast hits found.